Potri.012G097800 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G48540 306 / 1e-106 Cytidine/deoxycytidylate deaminase family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.015G096400 361 / 1e-128 AT3G48540 365 / 7e-130 Cytidine/deoxycytidylate deaminase family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10022452 276 / 7e-94 AT3G48540 313 / 6e-108 Cytidine/deoxycytidylate deaminase family protein (.1)
Lus10016755 231 / 2e-77 AT3G48540 259 / 3e-88 Cytidine/deoxycytidylate deaminase family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0109 CDA PF00383 dCMP_cyt_deam_1 Cytidine and deoxycytidylate deaminase zinc-binding region
Representative CDS sequence
>Potri.012G097800.3 pacid=42784098 polypeptide=Potri.012G097800.3.p locus=Potri.012G097800 ID=Potri.012G097800.3.v4.1 annot-version=v4.1
ATGAATTCACGAGAGCTCGCTCTTGTCTCCACAGCCACAGTCTTCGGAGCTTTAGCTTCTGCTTTTGCTGTTCGCTTCTACTCCAGCAACAGCAATTCCA
GAAAGCAGTTTTCCAAAATCGATTCGGTTCCAAACTGTGACGTTTCGAAGAAATGCTCTTCTCAGAGCCCCTTTGATCCTTCCAAACGCAAAGAGTATTT
ATCATGGGATGATTATTTTATGGCAATTGCACTTTTATCAGCTGAAAGGTCCAAAGATCCAAACAGGCAGGTTGGGGCGTGTTTGGTTAGTAAAAATGGC
ATAATTCTTGGCATTGGCTACAATGGATTTCCAAGAGGTTGTTCAGATGACGACCTTCCGTGGGCAAAGAAATCCAAATCTGGGGACCCTCTTGAGACAA
AGTACCCTTATGTTTGTCATGCTGAAGTCAATGCTATTCTGAACACAAATCATGCTTCTGCTGTTGGGCAGTCGGGCGTGTCTGAAGTTATATATTTTAT
AGAGAAGAACAATTCAGACATGGCGTACATTGCTTCACACAAGTTACTGTCCATGGCTGGTATTAAATTCAGAAAACACCAACCCCAGACGGACCAAATT
TCGATCAAGTTCCAAGAGTCCTAG
AA sequence
>Potri.012G097800.3 pacid=42784098 polypeptide=Potri.012G097800.3.p locus=Potri.012G097800 ID=Potri.012G097800.3.v4.1 annot-version=v4.1
MNSRELALVSTATVFGALASAFAVRFYSSNSNSRKQFSKIDSVPNCDVSKKCSSQSPFDPSKRKEYLSWDDYFMAIALLSAERSKDPNRQVGACLVSKNG
IILGIGYNGFPRGCSDDDLPWAKKSKSGDPLETKYPYVCHAEVNAILNTNHASAVGQSGVSEVIYFIEKNNSDMAYIASHKLLSMAGIKFRKHQPQTDQI
SIKFQES

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G48540 Cytidine/deoxycytidylate deami... Potri.012G097800 0 1
AT1G60800 NIK3 NSP-interacting kinase 3 (.1) Potri.010G043200 2.00 0.8228
AT4G12690 Plant protein of unknown funct... Potri.015G084500 4.69 0.8455
Potri.002G067900 14.49 0.7765
AT2G23300 Leucine-rich repeat protein ki... Potri.007G048800 17.08 0.7014
AT4G03500 Ankyrin repeat family protein ... Potri.019G106300 21.26 0.8124
AT5G45540 Protein of unknown function (D... Potri.015G107500 21.63 0.8206
AT3G60320 Protein of unknown function (D... Potri.014G047400 27.03 0.7921
AT4G04630 Protein of unknown function, D... Potri.011G004100 34.85 0.7940
AT2G17900 ASHR1, SDG37 ASH1-related 1, SET domain gro... Potri.005G173100 35.49 0.7570 SDG944,SDG37.1
AT2G26975 Ctr copper transporter family ... Potri.009G038700 37.22 0.7884 Pt-COPT2.1

Potri.012G097800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.