SEC61.1 (Potri.012G098400) [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol SEC61.1
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G50460 104 / 2e-31 secE/sec61-gamma protein transport protein (.1)
AT4G24920 104 / 2e-31 secE/sec61-gamma protein transport protein (.1)
AT3G48570 98 / 7e-29 secE/sec61-gamma protein transport protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.015G097300 110 / 6e-34 AT5G50460 103 / 3e-31 secE/sec61-gamma protein transport protein (.1)
Potri.001G329400 101 / 2e-30 AT5G50460 99 / 2e-29 secE/sec61-gamma protein transport protein (.1)
Potri.017G064032 80 / 1e-21 AT5G50460 101 / 4e-30 secE/sec61-gamma protein transport protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10035206 100 / 4e-30 AT5G50460 127 / 1e-40 secE/sec61-gamma protein transport protein (.1)
Lus10041552 101 / 6e-30 AT5G50460 127 / 4e-40 secE/sec61-gamma protein transport protein (.1)
Lus10012539 101 / 7e-30 AT5G50460 127 / 4e-40 secE/sec61-gamma protein transport protein (.1)
Lus10019065 57 / 2e-12 AT4G31985 100 / 2e-29 Ribosomal protein L39 family protein (.1)
Lus10032037 0 / 1 AT3G48560 96 / 3e-23 TRIAZOLOPYRIMIDINE RESISTANT 5, IMIDAZOLE RESISTANT 1, ACETOLACTATE SYNTHASE, ACETOHYDROXY ACID SYNTHASE, chlorsulfuron/imidazolinone resistant 1 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF00584 SecE SecE/Sec61-gamma subunits of protein translocation complex
Representative CDS sequence
>Potri.012G098400.1 pacid=42784307 polypeptide=Potri.012G098400.1.p locus=Potri.012G098400 ID=Potri.012G098400.1.v4.1 annot-version=v4.1
ATGGACGCCATAGATTCCGTCGTCGATCCTCTCAGAGAATTCGCTAAAGATAGCGTCCGACTCGTCAAACGCTGCCACAAACCCGATCAAAAAGAATTCA
CGAAGGTGGCGACTCGTACTGCAATCGGATTCGTGGTTATGGGATTTGTTGGGTTTTTCGTGAAGTTGATTTTTATCCCAATTAATAACATCATCGTTGG
TGCTTCTTAG
AA sequence
>Potri.012G098400.1 pacid=42784307 polypeptide=Potri.012G098400.1.p locus=Potri.012G098400 ID=Potri.012G098400.1.v4.1 annot-version=v4.1
MDAIDSVVDPLREFAKDSVRLVKRCHKPDQKEFTKVATRTAIGFVVMGFVGFFVKLIFIPINNIIVGAS

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G50460 secE/sec61-gamma protein trans... Potri.012G098400 0 1 SEC61.1
AT5G65300 unknown protein Potri.007G097000 3.46 0.8168
AT3G07600 Heavy metal transport/detoxifi... Potri.014G171500 4.00 0.8402
AT4G24380 unknown protein Potri.002G102500 9.79 0.7710
AT3G22930 CML11 calmodulin-like 11 (.1) Potri.008G159300 21.21 0.7633 Pt-SCAM.1
AT5G10695 unknown protein Potri.010G251000 22.69 0.7848
AT3G03280 unknown protein Potri.008G127200 23.00 0.7250
AT5G48655 RING/U-box superfamily protein... Potri.002G245500 25.09 0.7068
AT1G76650 CML38 calmodulin-like 38 (.1.2.3) Potri.001G332900 25.86 0.8090
AT5G39670 Calcium-binding EF-hand family... Potri.004G122900 25.92 0.7867
AT2G27600 ATSKD1, VPS4, S... VACUOLAR PROTEIN SORTING 4, SU... Potri.004G184500 30.38 0.6808

Potri.012G098400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.