Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G63500 79 / 1e-21 Protein of unknown function (DUF 3339) (.1) AT3G48660 80 / 2e-21 Protein of unknown function (DUF 3339) (.1) AT5G08391 69 / 2e-17 Protein of unknown function (DUF 3339) (.1) AT3G27027 62 / 7e-15 Protein of unknown function (DUF 3339) (.1) AT3G27030 64 / 1e-14 unknown protein AT3G01950 61 / 2e-14 Protein of unknown function (DUF 3339) (.1) AT5G14110 60 / 8e-14 Protein of unknown function (DUF 3339) (.1) AT5G50660 55 / 5e-12 Protein of unknown function (DUF 3339) (.1) AT5G50560 55 / 5e-12 Protein of unknown function (DUF 3339) (.1) AT5G40980 55 / 8e-12 Protein of unknown function (DUF 3339) (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G170400 [exp] 83 / 6e-23 AT3G48660 89 / 3e-25 Protein of unknown function (DUF 3339) (.1) Potri.015G098300 [exp] 81 / 6e-22 AT3G48660 107 / 3e-32 Protein of unknown function (DUF 3339) (.1) Potri.001G329000 [exp] 78 / 7e-21 AT5G08391 113 / 5e-35 Protein of unknown function (DUF 3339) (.1) Potri.001G058001 [exp] 75 / 2e-19 AT3G48660 74 / 9e-19 Protein of unknown function (DUF 3339) (.1) Potri.003G170500 [exp] 73 / 6e-19 AT5G08391 112 / 9e-35 Protein of unknown function (DUF 3339) (.1) Potri.017G064301 [exp] 71 / 3e-18 AT5G08391 108 / 5e-33 Protein of unknown function (DUF 3339) (.1) Potri.017G065444 [exp] 71 / 3e-18 AT3G48660 67 / 2e-16 Protein of unknown function (DUF 3339) (.1) Potri.001G057900 [exp] 70 / 7e-18 AT5G08391 113 / 6e-35 Protein of unknown function (DUF 3339) (.1) Potri.001G328701 [exp] 66 / 1e-15 AT3G27027 115 / 7e-35 Protein of unknown function (DUF 3339) (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10011353 [exp] 88 / 6e-25 AT3G48660 122 / 1e-38 Protein of unknown function (DUF 3339) (.1) Lus10003120 [exp] 86 / 3e-24 AT3G48660 121 / 5e-38 Protein of unknown function (DUF 3339) (.1) Lus10015769 [exp] 79 / 4e-21 AT3G48660 112 / 1e-34 Protein of unknown function (DUF 3339) (.1) Lus10037036 [exp] 78 / 4e-21 AT3G48660 112 / 3e-34 Protein of unknown function (DUF 3339) (.1) Lus10015770 [exp] 74 / 2e-19 AT5G08391 112 / 1e-34 Protein of unknown function (DUF 3339) (.1) Lus10037035 [exp] 72 / 8e-19 AT5G08391 111 / 2e-34 Protein of unknown function (DUF 3339) (.1) Lus10035201 [exp] 69 / 3e-17 AT5G08391 104 / 2e-31 Protein of unknown function (DUF 3339) (.1) Lus10032032 [exp] 69 / 3e-17 AT5G08391 104 / 2e-31 Protein of unknown function (DUF 3339) (.1) Lus10035198 [exp] 65 / 1e-15 AT3G48660 99 / 5e-29 Protein of unknown function (DUF 3339) (.1) Lus10032028 [exp] 65 / 1e-15 AT3G48660 99 / 5e-29 Protein of unknown function (DUF 3339) (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF11820 [poplar] [flax] DUF3339 Protein of unknown function (DUF3339)
Representative CDS sequence Show only first row Show all	>Potri.012G100100.1 pacid=42783862 polypeptide=Potri.012G100100.1.p locus=Potri.012G100100 ID=Potri.012G100100.1.v4.1 annot-version=v4.1 ATGGCAGATTGGGGACCGGTGATAGTAGCAGTGGTGCTGTTTGTGCTGTTAGTACCAGGGCTGTTATTTCAGATACCTGGAAGGAACAGGGTGGTTGAGT TTGGCAATATGCAGACGAGTGGTGCTTCTATTGTTGTCCATGCTATTATTTATTTTGGCCTCATCACCATCTTCCTTATTGCCATTGGTGTTCACATCTA TGCTGGCTAG
AA sequence Show only first row Show all	>Potri.012G100100.1 pacid=42783862 polypeptide=Potri.012G100100.1.p locus=Potri.012G100100 ID=Potri.012G100100.1.v4.1 annot-version=v4.1 MADWGPVIVAVVLFVLLVPGLLFQIPGRNRVVEFGNMQTSGASIVVHAIIYFGLITIFLIAIGVHIYAG

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G63500			Protein of unknown function (D...		Potri.012G100100 [exp]	0	1
AT3G18280			Bifunctional inhibitor/lipid-t...		Potri.017G118700 [exp]	1.41	0.8242
AT2G23260		UGT84B1	UDP-glucosyl transferase 84B1 ...		Potri.009G095200 [exp]	7.34	0.7665
AT4G17830			Peptidase M20/M25/M40 family p...		Potri.003G091100 [exp]	10.67	0.8410
AT2G28680			RmlC-like cupins superfamily p...		Potri.007G047200 [exp]	11.61	0.7392
AT1G22590	MADS	AGL87	AGAMOUS-like 87 (.1.2)		Potri.013G107600 [exp]	19.39	0.7624
AT1G32583			unknown protein		Potri.015G101000 [exp]	19.74	0.7561
AT5G23570		SGS3, ATSGS3	SUPPRESSOR OF GENE SILENCING 3...		Potri.003G188100 [exp]	20.49	0.7604
AT2G27035		AtENODL20	early nodulin-like protein 20 ...		Potri.017G088500 [exp]	22.58	0.8008
AT4G03140			NAD(P)-binding Rossmann-fold s...		Potri.014G135510 [exp]	23.49	0.7572
AT3G16520		UGT88A1	UDP-glucosyl transferase 88A1 ...		Potri.015G027800 [exp]	24.33	0.7482

Compare expression of checked genes

Potri.012G100100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.