Potri.012G100450 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.012G100450.1 pacid=42783762 polypeptide=Potri.012G100450.1.p locus=Potri.012G100450 ID=Potri.012G100450.1.v4.1 annot-version=v4.1
ATGCTTCGAGCTCCAAGTGGTAAATGCTTGATGGATCTTAATCAATCATCTTGCCATGTGGTAAGTATATACTGTGGAGAAAGTGGGGGATGTTGGGATG
GCTCAATCATGTCAAATCTCCCAAATTATGATGTTGGGTCTTTTAATCTGATTGAGCCGTGCCAATATCACACTTCTTATGATCCTTCAAATTTCTTTTT
ATTTGGTGCTTTTGATGGAAATATTTTTTCATATTTATCTTATTTTTCCTTTAACCTTTATCAATCAACTTCTATGTTATACCCAAATTTGCTGAATCCT
TATGATAAACACGTATAA
AA sequence
>Potri.012G100450.1 pacid=42783762 polypeptide=Potri.012G100450.1.p locus=Potri.012G100450 ID=Potri.012G100450.1.v4.1 annot-version=v4.1
MLRAPSGKCLMDLNQSSCHVVSIYCGESGGCWDGSIMSNLPNYDVGSFNLIEPCQYHTSYDPSNFFLFGAFDGNIFSYLSYFSFNLYQSTSMLYPNLLNP
YDKHV

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.012G100450 0 1
AT5G10530 Concanavalin A-like lectin pro... Potri.007G004500 1.73 0.8907
Potri.010G221301 2.82 0.8760
AT3G29400 ATEXO70E1 exocyst subunit exo70 family p... Potri.017G093650 3.00 0.8531
AT5G48060 C2 calcium/lipid-binding plant... Potri.001G271400 5.47 0.8667
Potri.015G072666 5.83 0.8874
Potri.019G089100 6.48 0.7786
AT2G15790 CYP40, SQN SQUINT, CYCLOPHILIN 40, peptid... Potri.009G106200 8.48 0.8218 SQN.1
AT2G42490 Copper amine oxidase family pr... Potri.015G082900 8.71 0.8217
AT5G53220 unknown protein Potri.015G022500 11.18 0.8075
AT1G09030 CCAAT NF-YB4 "nuclear factor Y, subunit B4"... Potri.005G027400 12.12 0.8595

Potri.012G100450 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.