Plant FIBer expression Database

Potri.012G101301 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
ATCG00220 62 / 8e-16 ATCG00220.1, PSBM photosystem II reaction center protein M (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G142100
[exp]
64 / 2e-16 ATCG00220 65 / 8e-17 photosystem II reaction center protein M (.1)
Flax homologues

No hit found
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF05151 PsbM Photosystem II reaction centre M protein (PsbM)
Representative CDS sequence
>Potri.012G101301.1 pacid=42783217 polypeptide=Potri.012G101301.1.p locus=Potri.012G101301 ID=Potri.012G101301.1.v4.1 annot-version=v4.1
ATGGAAGTAAATATTCTTGCATTTATTGCTACTGCACTGTTCATTCTAGTTCCTACTGCTTTTTTACTTATAATATATGTAAAAATTGTTAGTCAAAGTG
ATTAA
AA sequence
>Potri.012G101301.1 pacid=42783217 polypeptide=Potri.012G101301.1.p locus=Potri.012G101301 ID=Potri.012G101301.1.v4.1 annot-version=v4.1
MEVNILAFIATALFILVPTAFLLIIYVKIVSQSD

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
ATCG00220 ATCG00220.1, PS... photosystem II reaction center... Potri.012G101301
[exp]
0 1
AT4G33010 ATGLDP1 glycine decarboxylase P-protei... Potri.018G053640
[exp]
8.83 0.7093
AT4G33010 ATGLDP1 glycine decarboxylase P-protei... Potri.018G053680
[exp]
29.59 0.6893
Potri.013G162900
[exp]
34.72 0.6807
Potri.007G062162
[exp]
41.66 0.6833
ATCG01280 ATCG01280.1, YC... Chloroplast Ycf2;ATPase, AAA t... Potri.005G154512
[exp]
66.97 0.6739
AT3G09890 Ankyrin repeat family protein ... Potri.006G121500
[exp]
82.91 0.6636
AT1G15100 RHA2A RING-H2 finger A2A (.1) Potri.007G086300
[exp]
102.76 0.6130
AT4G03150 unknown protein Potri.014G135400
[exp]
121.91 0.6160
Potri.001G280332
[exp]
124.74 0.5986
ATMG00580 ATMG00580.1, NA... NADH dehydrogenase subunit 4 (... Potri.007G061881
[exp]
134.46 0.6404

Potri.012G101301 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.