Potri.012G103100 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G24990 208 / 4e-71 ATGP4 Ubiquitin family protein (.1)
AT3G26980 159 / 1e-51 MUB4 membrane-anchored ubiquitin-fold protein 4 precursor (.1)
AT1G77870 119 / 1e-35 MUB5 membrane-anchored ubiquitin-fold protein 5 precursor (.1)
AT1G22050 117 / 2e-35 MUB6 membrane-anchored ubiquitin-fold protein 6 precursor (.1)
AT3G01050 112 / 5e-33 MUB1 membrane-anchored ubiquitin-fold protein 1 precursor (.1)
AT5G15460 107 / 4e-31 MUB2 membrane-anchored ubiquitin-fold protein 2 (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.015G101200 224 / 9e-78 AT4G24990 197 / 6e-67 Ubiquitin family protein (.1)
Potri.001G325900 183 / 3e-61 AT3G26980 169 / 7e-56 membrane-anchored ubiquitin-fold protein 4 precursor (.1)
Potri.017G068100 170 / 4e-56 AT3G26980 154 / 1e-49 membrane-anchored ubiquitin-fold protein 4 precursor (.1)
Potri.004G124600 114 / 3e-34 AT3G01050 155 / 2e-50 membrane-anchored ubiquitin-fold protein 1 precursor (.1)
Potri.017G090700 112 / 4e-33 AT3G01050 157 / 7e-51 membrane-anchored ubiquitin-fold protein 1 precursor (.1)
Potri.002G091800 96 / 1e-26 AT1G22050 124 / 5e-38 membrane-anchored ubiquitin-fold protein 6 precursor (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10035184 167 / 1e-54 AT3G26980 178 / 3e-59 membrane-anchored ubiquitin-fold protein 4 precursor (.1)
Lus10032014 163 / 2e-53 AT3G26980 174 / 9e-58 membrane-anchored ubiquitin-fold protein 4 precursor (.1)
Lus10012555 177 / 1e-52 AT5G13990 608 / 0.0 exocyst subunit exo70 family protein C2 (.1)
Lus10041539 154 / 2e-49 AT3G26980 168 / 4e-55 membrane-anchored ubiquitin-fold protein 4 precursor (.1)
Lus10030704 103 / 7e-30 AT5G15460 150 / 2e-48 membrane-anchored ubiquitin-fold protein 2 (.1.2)
Lus10013190 103 / 1e-29 AT5G15460 150 / 8e-48 membrane-anchored ubiquitin-fold protein 2 (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0072 Ubiquitin PF00240 ubiquitin Ubiquitin family
Representative CDS sequence
>Potri.012G103100.2 pacid=42783845 polypeptide=Potri.012G103100.2.p locus=Potri.012G103100 ID=Potri.012G103100.2.v4.1 annot-version=v4.1
ATGCCGGAGGAGGATTTGGTGGATATAAAGTTCAGGCTTTATGACGGGTCGGATATCGGACCGTTCCGGTACTCATCGACGTCTACTGTTGATATGCTTA
AGCAGCGGATTGTTTCTGATTGGCCCAGAGGCAAAACAATAACTCCCAAGGCAGTGAATGAAATCAAGCTGATAAGCTCTGGTAAAGTCTTGGATAACAA
CAAGACCGTGGGTCAATGTAGAACACCTTTTGGAGAAGCGGCCGGGGGAGTTATCATAATGCATGTTGTTGTACAGCCATCTCTAGCAAAAACCAAAACA
GAAAAGAAGATTGATAAATCTCCGAAGAAAATCGTGTGCTCGTGTTCCATAATGTGA
AA sequence
>Potri.012G103100.2 pacid=42783845 polypeptide=Potri.012G103100.2.p locus=Potri.012G103100 ID=Potri.012G103100.2.v4.1 annot-version=v4.1
MPEEDLVDIKFRLYDGSDIGPFRYSSTSTVDMLKQRIVSDWPRGKTITPKAVNEIKLISSGKVLDNNKTVGQCRTPFGEAAGGVIIMHVVVQPSLAKTKT
EKKIDKSPKKIVCSCSIM

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT4G24990 ATGP4 Ubiquitin family protein (.1) Potri.012G103100 0 1
AT2G28370 Uncharacterised protein family... Potri.009G014600 1.41 0.9047
AT3G52790 peptidoglycan-binding LysM dom... Potri.008G030200 1.73 0.9168
AT4G24990 ATGP4 Ubiquitin family protein (.1) Potri.015G101200 3.00 0.9022
AT1G19130 unknown protein Potri.006G140000 3.74 0.8726
AT1G51200 A20/AN1-like zinc finger famil... Potri.006G056500 5.29 0.8867
AT3G27890 NQR NADPH:quinone oxidoreductase (... Potri.001G028000 6.32 0.8992 Pt-NQR.2
AT2G35680 Phosphotyrosine protein phosph... Potri.001G154700 6.85 0.8363
AT3G59490 unknown protein Potri.017G028900 6.92 0.8778
AT5G11440 CID5, IPD1 INCREASED POLYPLOIDY LEVEL IN ... Potri.006G246600 7.21 0.8628
AT1G12440 A20/AN1-like zinc finger famil... Potri.003G117100 7.48 0.8623

Potri.012G103100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.