Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	NAC062
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G13180 229 / 2e-75 NAC VNDIP2, ANAC083, VNI2 VND-interacting 2, NAC domain containing protein 83 (.1) AT2G33480 216 / 4e-70 NAC ANAC041 NAC domain containing protein 41 (.1.2) AT1G61110 185 / 2e-57 NAC ANAC025 NAC domain containing protein 25 (.1) AT3G04070 181 / 9e-56 NAC ANAC047 NAC domain containing protein 47 (.1.2) AT3G15510 181 / 3e-55 NAC ATNAC2, ANAC056, NARS1 NAC-REGULATED SEED MORPHOLOGY 1, Arabidopsis NAC domain containing protein 56, NAC domain containing protein 2 (.1) AT1G69490 177 / 6e-55 NAC NAP, ANAC029, ATNAP Arabidopsis NAC domain containing protein 29, NAC-like, activated by AP3/PI (.1) AT1G77450 171 / 1e-52 NAC ANAC032 NAC domain containing protein 32 (.1) AT1G52880 168 / 1e-50 NAC ATNAM, NAM, ANAC018, NARS2 NAC-REGULATED SEED MORPHOLOGY 2, Arabidopsis NAC domain containing protein 18, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) AT4G27410 166 / 3e-50 NAC RD26, ANAC072 NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1), NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.2), NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.3) AT1G01720 165 / 4e-50 NAC ATAF1, ANAC002 Arabidopsis NAC domain containing protein 2, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G102100 [exp] 375 / 2e-133 AT5G13180 232 / 8e-77 VND-interacting 2, NAC domain containing protein 83 (.1) Potri.001G061200 [exp] 272 / 2e-92 AT5G13180 310 / 6e-107 VND-interacting 2, NAC domain containing protein 83 (.1) Potri.003G166500 [exp] 268 / 7e-91 AT5G13180 310 / 4e-107 VND-interacting 2, NAC domain containing protein 83 (.1) Potri.011G046700 [exp] 189 / 2e-58 AT1G61110 331 / 8e-113 NAC domain containing protein 25 (.1) Potri.004G038000 [exp] 186 / 2e-57 AT1G61110 332 / 3e-113 NAC domain containing protein 25 (.1) Potri.001G404400 [exp] 184 / 1e-56 AT3G15510 345 / 1e-117 NAC-REGULATED SEED MORPHOLOGY 1, Arabidopsis NAC domain containing protein 56, NAC domain containing protein 2 (.1) Potri.011G123500 [exp] 182 / 7e-56 AT3G15510 323 / 4e-109 NAC-REGULATED SEED MORPHOLOGY 1, Arabidopsis NAC domain containing protein 56, NAC domain containing protein 2 (.1) Potri.019G031400 [exp] 182 / 1e-55 AT3G04070 332 / 1e-112 NAC domain containing protein 47 (.1.2) Potri.013G054000 [exp] 179 / 1e-54 AT3G04070 338 / 9e-115 NAC domain containing protein 47 (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10002581 [exp] 253 / 1e-84 AT5G13180 273 / 6e-93 VND-interacting 2, NAC domain containing protein 83 (.1) Lus10001809 [exp] 250 / 1e-83 AT5G13180 271 / 6e-92 VND-interacting 2, NAC domain containing protein 83 (.1) Lus10018469 [exp] 196 / 5e-61 AT1G61110 301 / 5e-101 NAC domain containing protein 25 (.1) Lus10011215 [exp] 195 / 6e-61 AT1G61110 305 / 1e-102 NAC domain containing protein 25 (.1) Lus10043095 [exp] 182 / 2e-55 AT3G15510 351 / 1e-119 NAC-REGULATED SEED MORPHOLOGY 1, Arabidopsis NAC domain containing protein 56, NAC domain containing protein 2 (.1) Lus10032657 [exp] 181 / 3e-55 AT3G15510 353 / 1e-120 NAC-REGULATED SEED MORPHOLOGY 1, Arabidopsis NAC domain containing protein 56, NAC domain containing protein 2 (.1) Lus10003269 [exp] 180 / 8e-55 AT3G04070 324 / 3e-109 NAC domain containing protein 47 (.1.2) Lus10030446 [exp] 177 / 1e-54 AT1G69490 302 / 2e-103 Arabidopsis NAC domain containing protein 29, NAC-like, activated by AP3/PI (.1) Lus10006547 [exp] 179 / 2e-54 AT3G04070 337 / 4e-114 NAC domain containing protein 47 (.1.2) Lus10037156 [exp] 176 / 3e-54 AT1G69490 318 / 2e-109 Arabidopsis NAC domain containing protein 29, NAC-like, activated by AP3/PI (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02365 [poplar] [flax] NAM No apical meristem (NAM) protein
Representative CDS sequence Show only first row Show all	>Potri.012G103500.2 pacid=42784025 polypeptide=Potri.012G103500.2.p locus=Potri.012G103500 ID=Potri.012G103500.2.v4.1 annot-version=v4.1 ATGGAAAACTTCAACTTTGTAAGAGATGGAATGAGCGGATTGCCTCCTGGTTTTCGCTTCCAACCAACTGAAGAAGAGCTTGTCTTTCAGTACCTTAAAC GCAAAATCCTTTCATGGCCATTGCCTGCTTCAGTCATTCCTGAGGTCAATGTCTGCAAGTATGATCCCTGGGAACTGCCAGGTGACATGGAGCAAGAAAG ATACTTCTTCAGCAACAAGGAGGCCAAGTATCCAAATGGAAACAGGGTCAACAGAGCTAGTTCGTCAGGTTATTGGAAAGCAACTGGCTTAGACAGACAA ATAGTTTCTTCAAGCTGGAAGAATAACCATGTTGTAGGGATGAAAAAGACTCTTGTTTTTTATAGAGGGAAGGCTCCACATGGATCCAGAACTGACTGGG TCATGCATGAATATCGCCTTGTTAATTTAGGAGTAGAAACTACAGATAGCAATTTTCCACAGACAGAAAACTCAGCCCAGCAGAATTCATCTTTTCAAAT GGACAAATGGGTTGTATGCCGAATATTCCTGAAAAACAAAGGCGCAGCAACAACTGAGATAACTGAAACTCGTACAAATGACAACGTTGGGGGAACTCAG CCAAGACTCTTTGATTTTATGGGGAGAGACGAGATTGTTTTTGATTCTGCCTCGTCTGCATGTTCGAGCTCTAGTAGTCTTGCTGGCATCTCTTCAAATG AACAAGATCATGAGCAAAGCAGTACGTAG
AA sequence Show only first row Show all	>Potri.012G103500.2 pacid=42784025 polypeptide=Potri.012G103500.2.p locus=Potri.012G103500 ID=Potri.012G103500.2.v4.1 annot-version=v4.1 MENFNFVRDGMSGLPPGFRFQPTEEELVFQYLKRKILSWPLPASVIPEVNVCKYDPWELPGDMEQERYFFSNKEAKYPNGNRVNRASSSGYWKATGLDRQ IVSSSWKNNHVVGMKKTLVFYRGKAPHGSRTDWVMHEYRLVNLGVETTDSNFPQTENSAQQNSSFQMDKWVVCRIFLKNKGAATTEITETRTNDNVGGTQ PRLFDFMGRDEIVFDSASSACSSSSSLAGISSNEQDHEQSST

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G13180	NAC	VNDIP2, ANAC083...	VND-interacting 2, NAC domain ...		Potri.012G103500 [exp]	0	1	NAC062
AT2G19480		NFA2, NFA02, NA...	NUCLEOSOME/CHROMATIN ASSEMBLY ...		Potri.003G021400 [exp]	7.93	0.9204	NFA903
AT2G20560			DNAJ heat shock family protein...		Potri.007G136600 [exp]	8.48	0.9170
AT1G53580		GLY3, GLX2-3, E...	GLYOXALASE 2-3, ETHE1-LIKE, gl...		Potri.001G380100 [exp]	9.89	0.8729
AT3G48770			DNA binding;ATP binding (.1)		Potri.015G102700 [exp]	15.87	0.8990
AT5G18970			AWPM-19-like family protein (....		Potri.008G200300 [exp]	17.66	0.9168
AT2G20560			DNAJ heat shock family protein...		Potri.007G136133 [exp]	18.65	0.8854
AT3G20570		AtENODL9	early nodulin-like protein 9 (...		Potri.011G135400 [exp]	20.19	0.9143
AT5G22870			Late embryogenesis abundant (L...		Potri.009G003800 [exp]	20.85	0.9131
AT1G72210	bHLH	bHLH096	basic helix-loop-helix (bHLH) ...		Potri.002G101900 [exp]	22.69	0.8490
AT3G18260			Reticulon family protein (.1)		Potri.012G054100 [exp]	22.97	0.9117

Compare expression of checked genes

Potri.012G103500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.