Potri.012G105300 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G25050 107 / 7e-31 ACP4 acyl carrier protein 4 (.1.2)
AT3G05020 94 / 3e-25 ACP1 acyl carrier protein 1 (.1)
AT1G54580 92 / 2e-24 ACP2 acyl carrier protein 2 (.1)
AT1G54630 91 / 2e-24 ACP3 acyl carrier protein 3 (.1.2)
AT5G27200 89 / 1e-23 ACP5 acyl carrier protein 5 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.015G104500 176 / 9e-58 AT4G25050 122 / 2e-36 acyl carrier protein 4 (.1.2)
Potri.005G044800 113 / 6e-33 AT5G27200 146 / 5e-46 acyl carrier protein 5 (.1)
Potri.013G031300 110 / 8e-32 AT3G05020 142 / 1e-44 acyl carrier protein 1 (.1)
Potri.006G217800 76 / 4e-18 AT1G54630 94 / 2e-25 acyl carrier protein 3 (.1.2)
Potri.013G084500 40 / 0.0001 AT1G65290 188 / 5e-63 mitochondrial acyl carrier protein 2 (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10018986 112 / 1e-32 AT4G25050 136 / 3e-42 acyl carrier protein 4 (.1.2)
Lus10033836 110 / 7e-32 AT4G25050 137 / 2e-42 acyl carrier protein 4 (.1.2)
Lus10038636 106 / 3e-30 AT4G25050 134 / 3e-41 acyl carrier protein 4 (.1.2)
Lus10038635 106 / 3e-30 AT4G25050 134 / 3e-41 acyl carrier protein 4 (.1.2)
Lus10037910 105 / 5e-30 AT4G25050 130 / 4e-40 acyl carrier protein 4 (.1.2)
Lus10037908 105 / 6e-30 AT4G25050 132 / 8e-41 acyl carrier protein 4 (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0314 PP-binding PF00550 PP-binding Phosphopantetheine attachment site
Representative CDS sequence
>Potri.012G105300.1 pacid=42783860 polypeptide=Potri.012G105300.1.p locus=Potri.012G105300 ID=Potri.012G105300.1.v4.1 annot-version=v4.1
ATGGCCACAGTCTCAGCTACTTGTCTTAGGTTCCAGCCTTTGTTTAGCCAGTCAAACAAGAGTAGTCAGGCAGCAGCTAGTTTAAAGCCTGTGTCAGTGG
GTTGGGCAAAGAATAATGGCTTCCCTTCTTTGAAGGCCTCTCGATTCCGTGTCTCTTGTGCTGCAAAGCCAGAGACCGTGGAGAAAGTTATTGAGATTGT
GAGGAAACAACTGGCTTTGACTCCTGAGACTGAGCTCACCAACGAATCCAAGTTCGCTGCACTTGGTGCTGACTCTCTTGACACAGTGGAGATAGTAATG
GCACTGGAAGAAGAATTTGACATTAATGTAGAAGAGGAGAACTCTCAGAACATAACAACAGTCCGAGAAGCAGCTGACATGATTGATAAACTTGTTCAAG
ACAAAGCTGAAGGTTGA
AA sequence
>Potri.012G105300.1 pacid=42783860 polypeptide=Potri.012G105300.1.p locus=Potri.012G105300 ID=Potri.012G105300.1.v4.1 annot-version=v4.1
MATVSATCLRFQPLFSQSNKSSQAAASLKPVSVGWAKNNGFPSLKASRFRVSCAAKPETVEKVIEIVRKQLALTPETELTNESKFAALGADSLDTVEIVM
ALEEEFDINVEEENSQNITTVREAADMIDKLVQDKAEG

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT4G25050 ACP4 acyl carrier protein 4 (.1.2) Potri.012G105300 0 1
AT4G15510 Photosystem II reaction center... Potri.013G006500 1.00 0.9746
AT1G74070 Cyclophilin-like peptidyl-prol... Potri.012G058700 2.44 0.9673
AT4G05180 PSII-Q, PSBQ, P... photosystem II subunit Q-2 (.1... Potri.011G031300 4.00 0.9708 Pt-PSBQ2.2
AT5G19440 NAD(P)-binding Rossmann-fold s... Potri.009G057800 7.74 0.9292 Pt-CCR.6
AT1G08380 PSAO photosystem I subunit O (.1) Potri.009G160800 8.24 0.9593
AT5G24460 unknown protein Potri.010G149800 9.48 0.9554
AT5G54190 PORA protochlorophyllide oxidoreduc... Potri.001G403300 10.58 0.9426 PORA.2
AT1G60950 FED A, ATFD2, F... FERREDOXIN 2, 2Fe-2S ferredoxi... Potri.003G015200 11.22 0.9397 Pt-PETF.4
AT5G08280 HEMC hydroxymethylbilane synthase (... Potri.007G072500 12.00 0.9370
AT3G25920 RPL15 ribosomal protein L15 (.1) Potri.008G121100 13.41 0.9548

Potri.012G105300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.