Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G33550 66 / 5e-14 Trihelix Homeodomain-like superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G105800 [exp] 100 / 1e-26 AT2G33550 187 / 9e-57 Homeodomain-like superfamily protein (.1) Potri.003G163000 [exp] 68 / 6e-15 AT2G33550 340 / 9e-117 Homeodomain-like superfamily protein (.1) Potri.001G066900 [exp] 66 / 5e-14 AT2G33550 328 / 4e-112 Homeodomain-like superfamily protein (.1)
Flax homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.012G106650.2 pacid=42784185 polypeptide=Potri.012G106650.2.p locus=Potri.012G106650 ID=Potri.012G106650.2.v4.1 annot-version=v4.1 ATGTCTAGGGAGGGACGGAAGAAGAGGCGCTTATCATCAGATGAATGTGAGGACACCAATCTTAGGGACATGAACATGCTGAAGTCCCAACTACAAGCTC AAAACACTAATTGTAAGCTGGATAGGGAACAAAGGACGGACCATAATGATAGCTTAGTCAGTGCACTCAATAAGCTCACAGATGCTTTAGTAAAAATTGC TGATAATGGTTCAAAACAAAGAGATGTTTATGAAGCTTCCTACATTGTAAATGAGCATTATGACATATGCTAG
AA sequence Show only first row Show all	>Potri.012G106650.2 pacid=42784185 polypeptide=Potri.012G106650.2.p locus=Potri.012G106650 ID=Potri.012G106650.2.v4.1 annot-version=v4.1 MSREGRKKRRLSSDECEDTNLRDMNMLKSQLQAQNTNCKLDREQRTDHNDSLVSALNKLTDALVKIADNGSKQRDVYEASYIVNEHYDIC

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G33550	Trihelix		Homeodomain-like superfamily p...		Potri.012G106650 [exp]	0	1
AT2G47180		ATGOLS1	galactinol synthase 1 (.1)		Potri.002G191600 [exp]	11.70	0.8650	Pt-GOLS2.2
AT5G03990			unknown protein		Potri.006G045900 [exp]	23.15	0.8514
AT4G30030			Eukaryotic aspartyl protease f...		Potri.018G106500 [exp]	28.72	0.8501
AT4G37680		HHP4	heptahelical protein 4 (.1.2)		Potri.007G005800 [exp]	35.63	0.8370
AT3G24130			Pectin lyase-like superfamily ...		Potri.017G054700 [exp]	50.79	0.8138
AT1G10040			alpha/beta-Hydrolases superfam...		Potri.002G113000 [exp]	66.54	0.7620
					Potri.006G021800 [exp]	100.49	0.7746
AT5G01650			Tautomerase/MIF superfamily pr...		Potri.016G126700 [exp]	125.85	0.7127
AT5G40780		LHT1, LTH1	lysine histidine transporter 1...		Potri.001G335200 [exp]	129.39	0.7810
					Potri.003G030200 [exp]	130.31	0.7685

Compare expression of checked genes

Potri.012G106650 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.