Potri.012G107300 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G07080 206 / 8e-66 Thioredoxin superfamily protein (.1)
AT5G01580 186 / 1e-58 OSH1 OAS HIGH ACCUMULATION 1, gamma interferon responsive lysosomal thiol (GILT) reductase family protein (.1)
AT4G12890 186 / 2e-58 Gamma interferon responsive lysosomal thiol (GILT) reductase family protein (.1)
AT4G12960 174 / 7e-54 GILT, AtGILT gamma-interferon-responsive lysosomal thiol reductase, Gamma interferon responsive lysosomal thiol (GILT) reductase family protein (.1), Gamma interferon responsive lysosomal thiol (GILT) reductase family protein (.2)
AT4G12900 170 / 3e-52 Gamma interferon responsive lysosomal thiol (GILT) reductase family protein (.1)
AT4G12870 167 / 3e-51 Gamma interferon responsive lysosomal thiol (GILT) reductase family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.012G107600 517 / 0 AT1G07080 204 / 2e-65 Thioredoxin superfamily protein (.1)
Potri.016G122200 486 / 3e-176 AT1G07080 204 / 3e-65 Thioredoxin superfamily protein (.1)
Potri.016G121900 202 / 7e-65 AT5G01580 263 / 3e-89 OAS HIGH ACCUMULATION 1, gamma interferon responsive lysosomal thiol (GILT) reductase family protein (.1)
Potri.009G076200 201 / 7e-64 AT1G07080 278 / 3e-94 Thioredoxin superfamily protein (.1)
Potri.006G103000 191 / 6e-60 AT1G07080 196 / 3e-62 Thioredoxin superfamily protein (.1)
Potri.001G281004 184 / 1e-57 AT1G07080 266 / 8e-90 Thioredoxin superfamily protein (.1)
Potri.016G122000 179 / 7e-56 AT1G07080 185 / 3e-58 Thioredoxin superfamily protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10042270 213 / 1e-68 AT1G07080 285 / 5e-97 Thioredoxin superfamily protein (.1)
Lus10026384 213 / 1e-68 AT1G07080 281 / 1e-95 Thioredoxin superfamily protein (.1)
Lus10022669 202 / 7e-65 AT1G07080 170 / 2e-52 Thioredoxin superfamily protein (.1)
Lus10012503 191 / 2e-60 AT1G07080 171 / 1e-52 Thioredoxin superfamily protein (.1)
Lus10002203 188 / 3e-59 AT5G01580 238 / 2e-79 OAS HIGH ACCUMULATION 1, gamma interferon responsive lysosomal thiol (GILT) reductase family protein (.1)
Lus10022670 150 / 1e-41 AT4G00620 527 / 0.0 EMBRYO DEFECTIVE 3127, Amino acid dehydrogenase family protein (.1)
Lus10012502 139 / 3e-37 AT4G00620 442 / 6e-152 EMBRYO DEFECTIVE 3127, Amino acid dehydrogenase family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0172 Thioredoxin PF03227 GILT Gamma interferon inducible lysosomal thiol reductase (GILT)
Representative CDS sequence
>Potri.012G107300.1 pacid=42784137 polypeptide=Potri.012G107300.1.p locus=Potri.012G107300 ID=Potri.012G107300.1.v4.1 annot-version=v4.1
ATGGGCTCTTCTCCATTACTCTCTTTCCTTGTTCTCACTCTGATGTTCTTGTTCGTCACCCCTTCCCATTCTTCGGAGTACGATGCTGCTCAGGAACCAG
CGCCTCCCTTTACGTCCAGGAAAATCTCTCGCAATTCTGAGAAAGTTACAATGTCTTTATATTATGAATCTCTTTGTCCATATTGCAGCAGTTTCATTGT
AGGTCCCCTAGCTCAGGTCCTGGAGACTGATCTCATGACCATTCTCAATCTCAGACTGGTTCCATGGGGAAATGCTATTCTAGACTCCAACAGTACCATT
GAGTGTCAGCATGGGGAAGATGAATGCTATCTGAACATCATACATACTTGTGCCATCAACCTCTGGCCTGATTTGAAGAAGCACTTCAATTTCATCAAGT
GTATCGAAAAGCAATATAAAGCTCCTGATAGAAATGGAGCAGAAGAATCCTGGGAAGTATGTTCTGGTAAATTGAGACTGTCTACAAAATCCATTAAGAA
ATGCTATGACAGTGGACATGGAAAAAAGCTTGTCCTACAAAATGGAAAAGAAACAGATCATCTCAGACCGCCTCACGAATACGTGCCATGGGTGGTTGTA
GATGATACACCTCTCCTCGATGACTATGTGAATTTCATTCACTATGTTTGCAAGGCATACAAAGGCAAGTCTTTGCCCAAGACTTGCAGTTCACATCCCA
ACACCTCAATTAACAAGGACACCTCACTCCAATCAGCCTGTCATGCAAGTGAAGCAATGTCAGGTGACAGTTCAGGGAAGCACCAGATGAAGATGGAACC
CCTTGCATGA
AA sequence
>Potri.012G107300.1 pacid=42784137 polypeptide=Potri.012G107300.1.p locus=Potri.012G107300 ID=Potri.012G107300.1.v4.1 annot-version=v4.1
MGSSPLLSFLVLTLMFLFVTPSHSSEYDAAQEPAPPFTSRKISRNSEKVTMSLYYESLCPYCSSFIVGPLAQVLETDLMTILNLRLVPWGNAILDSNSTI
ECQHGEDECYLNIIHTCAINLWPDLKKHFNFIKCIEKQYKAPDRNGAEESWEVCSGKLRLSTKSIKKCYDSGHGKKLVLQNGKETDHLRPPHEYVPWVVV
DDTPLLDDYVNFIHYVCKAYKGKSLPKTCSSHPNTSINKDTSLQSACHASEAMSGDSSGKHQMKMEPLA

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G07080 Thioredoxin superfamily protei... Potri.012G107300 0 1
AT1G07080 Thioredoxin superfamily protei... Potri.012G107600 1.00 0.9821
AT1G08650 ATPPCK1, PPCK1 phosphoenolpyruvate carboxylas... Potri.010G071400 7.48 0.9749
Potri.001G259224 9.89 0.9717
AT3G55870 ADC synthase superfamily prote... Potri.008G066600 10.39 0.9734 Pt-ASA1.1,ASA%2C,pseudogene
Potri.012G007445 10.95 0.9738
AT1G65420 NPQ7 NONPHOTOCHEMICAL QUENCHING 7, ... Potri.008G076900 15.09 0.9324
AT1G79915 Putative methyltransferase fam... Potri.001G181200 16.12 0.8720
Potri.016G020750 16.24 0.9593
Potri.012G007866 16.43 0.9615
Potri.012G008845 17.43 0.9604

Potri.012G107300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.