RPL34.4 (Potri.012G108400) [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol RPL34.4
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G26880 186 / 2e-62 Ribosomal protein L34e superfamily protein (.1.2)
AT1G69620 184 / 2e-61 RPL34 ribosomal protein L34 (.1)
AT3G28900 178 / 2e-59 Ribosomal protein L34e superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G082200 191 / 2e-64 AT1G26880 187 / 7e-63 Ribosomal protein L34e superfamily protein (.1.2)
Potri.015G106466 191 / 3e-64 AT1G26880 187 / 1e-62 Ribosomal protein L34e superfamily protein (.1.2)
Potri.015G106532 191 / 3e-64 AT1G26880 187 / 1e-62 Ribosomal protein L34e superfamily protein (.1.2)
Potri.001G195101 182 / 9e-61 AT1G26880 178 / 3e-59 Ribosomal protein L34e superfamily protein (.1.2)
Potri.004G029400 169 / 2e-55 AT1G26880 168 / 6e-55 Ribosomal protein L34e superfamily protein (.1.2)
Potri.012G108301 108 / 3e-32 AT1G26880 105 / 3e-31 Ribosomal protein L34e superfamily protein (.1.2)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10042199 186 / 2e-62 AT1G26880 217 / 8e-75 Ribosomal protein L34e superfamily protein (.1.2)
Lus10037177 186 / 2e-62 AT1G26880 219 / 2e-75 Ribosomal protein L34e superfamily protein (.1.2)
Lus10012829 186 / 2e-62 AT1G26880 219 / 2e-75 Ribosomal protein L34e superfamily protein (.1.2)
Lus10030477 186 / 2e-62 AT1G26880 219 / 2e-75 Ribosomal protein L34e superfamily protein (.1.2)
Lus10036750 184 / 8e-62 AT1G26880 217 / 8e-75 Ribosomal protein L34e superfamily protein (.1.2)
Lus10008617 184 / 2e-61 AT1G26880 215 / 8e-74 Ribosomal protein L34e superfamily protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01199 Ribosomal_L34e Ribosomal protein L34e
Representative CDS sequence
>Potri.012G108400.2 pacid=42783042 polypeptide=Potri.012G108400.2.p locus=Potri.012G108400 ID=Potri.012G108400.2.v4.1 annot-version=v4.1
ATGGTGCAGCGTCTGACTTACCGGAAGCGTCACAGCTACGCCACAAAATCTAACCAACACCGTGTGGTCAAAACCCCTGGTGGGAAATTGGTTTACCAAA
CCACCAAGAAGAGGGCTAGCGGACCCAAGTGCCCAGTTACTGGCAAGAGGATTCAAGGGATCCCTCACTTGAGACCTGCTGAATACAAGAGGTCTAGACT
GTCAAGGAATCGCAGGACTGTGAACCGTGCCTATGGTGGAGTCTTATCTGGAAGTGCTGTTAGGGAGAGAATTATCCGGGCTTTCTTGGTGGAGGAGCAA
AAGATTGTGAAGAAGGTTTTGAAGATTCAGAAGGCAAAGGAAAAACAGGCCTCAAAATGA
AA sequence
>Potri.012G108400.2 pacid=42783042 polypeptide=Potri.012G108400.2.p locus=Potri.012G108400 ID=Potri.012G108400.2.v4.1 annot-version=v4.1
MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPAEYKRSRLSRNRRTVNRAYGGVLSGSAVRERIIRAFLVEEQ
KIVKKVLKIQKAKEKQASK

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G26880 Ribosomal protein L34e superfa... Potri.012G108400 0 1 RPL34.4
AT5G02960 Ribosomal protein S12/S23 fami... Potri.010G217100 1.41 0.9034 RPS23.2
AT3G52580 Ribosomal protein S11 family p... Potri.001G218700 2.23 0.9201
AT5G20920 EIF2 BETA, EMB1... embryo defective 1401, eukaryo... Potri.019G131200 4.00 0.9017 EIF2.2
AT3G04400 EMB2171 embryo defective 2171, Ribosom... Potri.002G257500 4.47 0.8943
AT1G26880 Ribosomal protein L34e superfa... Potri.017G082200 5.47 0.9027 Pt-RPL34.5
AT1G67430 Ribosomal protein L22p/L17e fa... Potri.010G060400 6.00 0.8938
AT3G61110 ARS27A ribosomal protein S27 (.1) Potri.001G069100 7.14 0.8658 Pt-ARS27.2
AT5G12320 ankyrin repeat family protein ... Potri.001G276100 8.36 0.8446
AT5G10360 RPS6B, EMB3010 Ribosomal protein small subuni... Potri.001G311000 8.36 0.8722
AT5G64140 RPS28 ribosomal protein S28 (.1) Potri.010G245400 13.22 0.8515 Pt-RPS28.1

Potri.012G108400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.