Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G065800 [exp] 176 / 3e-54 AT4G18390 151 / 2e-41 TEOSINTE BRANCHED 1, cycloidea and PCF transcription factor 2 (.1.2) Potri.011G083100 [exp] 146 / 7e-43 AT4G18390 150 / 5e-41 TEOSINTE BRANCHED 1, cycloidea and PCF transcription factor 2 (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10038512 [exp] 74 / 4e-16 AT4G18390 204 / 1e-60 TEOSINTE BRANCHED 1, cycloidea and PCF transcription factor 2 (.1.2) Lus10023297 [exp] 59 / 5e-11 AT4G18390 207 / 8e-63 TEOSINTE BRANCHED 1, cycloidea and PCF transcription factor 2 (.1.2)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.012G109000.1 pacid=42782512 polypeptide=Potri.012G109000.1.p locus=Potri.012G109000 ID=Potri.012G109000.1.v4.1 annot-version=v4.1 ATGGACTACATCAGCACAGGGCTTTTAGGGCCTTCCTCGTCATGGACAACTCATCATTCATCGGGGTTTCCAGGGCAAATCCAGTTAGGGAACTCAATCC CACAACCAATGACAATGTCGGTCCCGCCATTCAATGTATCAGGAGAGAATCACGAAGAGGAATTGCAACATTTTCCTTTCATTTGCGATCATTTGATCCC AGTGGCGGCCACAACACAAACAGTTGGGGATTATAATCTGAATTTTACAATATCTTCAAGCCTTGCTGCTGGTTTCAATAGGGGGACCCTTCAGTCCAAT CCCCACGTTACTCTTGGGTCTGGTTGCCCAGCCGACCCAGTAACCTCGGGTCTGGCTGGGTAG
AA sequence Show only first row Show all	>Potri.012G109000.1 pacid=42782512 polypeptide=Potri.012G109000.1.p locus=Potri.012G109000 ID=Potri.012G109000.1.v4.1 annot-version=v4.1 MDYISTGLLGPSSSWTTHHSSGFPGQIQLGNSIPQPMTMSVPPFNVSGENHEEELQHFPFICDHLIPVAATTQTVGDYNLNFTISSSLAAGFNRGTLQSN PHVTLGSGCPADPVTSGLAG

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
					Potri.012G109000 [exp]	0	1
					Potri.001G280332 [exp]	8.48	0.6484
AT3G27890		NQR	NADPH:quinone oxidoreductase (...		Potri.003G195700 [exp]	10.39	0.6591	Pt-NQR.3
AT4G33010		ATGLDP1	glycine decarboxylase P-protei...		Potri.018G053640 [exp]	12.52	0.6607
AT5G54880			DTW domain-containing protein ...		Potri.001G423900 [exp]	38.49	0.6135
AT4G00310		MEE46, EDA8	MATERNAL EFFECT EMBRYO ARREST ...		Potri.002G161700 [exp]	45.16	0.5983
AT3G16460		JAL34	jacalin-related lectin 34, Man...		Potri.017G010900 [exp]	62.16	0.5750
AT3G10940		LSF2	LIKE SEX4 2, dual specificity ...		Potri.019G048600 [exp]	63.49	0.5961
AT4G38160		PDE191	pigment defective 191, Mitocho...		Potri.009G170300 [exp]	68.93	0.6024
AT3G56720			unknown protein		Potri.016G036000 [exp]	108.44	0.5369
AT4G32980	HD	ATH1	homeobox gene 1 (.1)		Potri.018G054700 [exp]	136.99	0.5371

Compare expression of checked genes

Potri.012G109000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.