Potri.012G109100 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G56860 45 / 7e-06 UBA2A UBP1-associated protein 2A (.1.2.3.4.5)
AT2G41060 45 / 8e-06 RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G025600 96 / 2e-23 AT3G56860 353 / 2e-117 UBP1-associated protein 2A (.1.2.3.4.5)
Potri.016G023800 82 / 2e-18 AT3G56860 348 / 1e-115 UBP1-associated protein 2A (.1.2.3.4.5)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10032516 56 / 2e-09 AT3G56860 405 / 6e-139 UBP1-associated protein 2A (.1.2.3.4.5)
Lus10043016 55 / 3e-09 AT3G56860 463 / 1e-160 UBP1-associated protein 2A (.1.2.3.4.5)
PFAM info
Representative CDS sequence
>Potri.012G109100.2 pacid=42783150 polypeptide=Potri.012G109100.2.p locus=Potri.012G109100 ID=Potri.012G109100.2.v4.1 annot-version=v4.1
ATGTTGCTAGAAAGGGCATTTACCTTCGGATTATTGAAAAATAATATATTGAGATTGGGTCTTTTGGGTCTGGTTACCTGGGTCTGCTCTACTCTTCAAA
ATCCATGGCTAAAAAACAAAAGCTCAACTCCATATCCACCCAAACAGCAGAAAGAACTGCCGAAGAAACAACAACAACAAAAAGAGCCACAAAAGGAAGA
ACCTCAACAACAAGAAGAGGAAGAGGAAGAGGAAGAAGAATATGAAGAAGTGGAAGAGGAGGAAGAAGATAATGAAGATGATCCAGATGAAGAAACCAAT
CAAAATGCTCAGATCTCAGCTGTTGAGAATCTAAACGACGACGATGACGAAGATGAGGAACCGACTGAGAAACTTCTTAAACCGTTTGGAAAAGACCAGT
TGATTAATTTACTTCGTGAAGCAGCGGATGGTCACCGAGATTTTGCAGATAAAATCCAACAAGTGGCTGACCTTAAAAGAAGGACCATTAGGGCATGA
AA sequence
>Potri.012G109100.2 pacid=42783150 polypeptide=Potri.012G109100.2.p locus=Potri.012G109100 ID=Potri.012G109100.2.v4.1 annot-version=v4.1
MLLERAFTFGLLKNNILRLGLLGLVTWVCSTLQNPWLKNKSSTPYPPKQQKELPKKQQQQKEPQKEEPQQQEEEEEEEEEYEEVEEEEEDNEDDPDEETN
QNAQISAVENLNDDDDEDEEPTEKLLKPFGKDQLINLLREAADGHRDFADKIQQVADLKRRTIRA

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G56860 UBA2A UBP1-associated protein 2A (.1... Potri.012G109100 0 1
AT1G24267 Protein of unknown function (D... Potri.003G169200 5.65 0.7078
AT3G12050 Aha1 domain-containing protein... Potri.016G060100 11.04 0.7878
AT1G78530 Protein kinase superfamily pro... Potri.011G101900 18.43 0.7833
AT4G27640 ARM repeat superfamily protein... Potri.010G169800 25.21 0.7037
AT4G35870 early-responsive to dehydratio... Potri.005G108600 26.72 0.7094
AT5G02920 F-box/RNI-like superfamily pro... Potri.017G146500 29.13 0.7667
AT5G12410 THUMP domain-containing protei... Potri.001G254600 30.46 0.7565
AT3G51980 ARM repeat superfamily protein... Potri.003G158701 34.89 0.6865
AT2G33730 P-loop containing nucleoside t... Potri.015G037200 37.94 0.6864
AT4G24190 AtHsp90-7, HSP9... SHEPHERD, HEAT SHOCK PROTEIN 9... Potri.005G241100 62.35 0.6689

Potri.012G109100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.