Potri.012G110750 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.012G110750.1 pacid=42783176 polypeptide=Potri.012G110750.1.p locus=Potri.012G110750 ID=Potri.012G110750.1.v4.1 annot-version=v4.1
ATGCCTTTCTTCTGGGTTTTCTTAGTTCTTTTGTGTTCATGCCATCATTGGCATAAACTGCTTATGTTTTCAACCAAGATTCCTGTACTGGTAGGTTAA
AA sequence
>Potri.012G110750.1 pacid=42783176 polypeptide=Potri.012G110750.1.p locus=Potri.012G110750 ID=Potri.012G110750.1.v4.1 annot-version=v4.1
MPFFWVFLVLLCSCHHWHKLLMFSTKIPVLVG

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.012G110750 0 1
Potri.001G268900 1.00 0.9182
AT1G16310 Cation efflux family protein (... Potri.010G172800 4.89 0.8707
AT1G35910 TPPD trehalose-6-phosphate phosphat... Potri.012G001000 10.29 0.8744
AT2G35790 unknown protein Potri.008G042800 11.66 0.8555
Potri.015G106700 11.74 0.7962
AT3G09390 ATMT-K, ATMT-1,... ARABIDOPSIS THALIANA METALLOTH... Potri.001G040200 15.49 0.8694
AT3G09390 ATMT-K, ATMT-1,... ARABIDOPSIS THALIANA METALLOTH... Potri.001G041268 18.43 0.8656
Potri.017G080900 18.97 0.8588
AT3G30210 MYB ATMYB121 myb domain protein 121 (.1) Potri.017G099500 18.97 0.8523
AT5G50610 unknown protein Potri.015G099800 21.42 0.8166

Potri.012G110750 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.