Potri.012G111000 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G07330 130 / 5e-39 unknown protein
AT1G63060 74 / 6e-17 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.015G109100 272 / 6e-95 AT5G07330 133 / 3e-40 unknown protein
Potri.012G110900 114 / 6e-33 AT5G07330 81 / 5e-20 unknown protein
Potri.003G160700 111 / 1e-31 AT1G63060 114 / 4e-33 unknown protein
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10018040 128 / 5e-38 AT5G07330 117 / 1e-33 unknown protein
Lus10042036 125 / 5e-37 AT5G07330 118 / 3e-34 unknown protein
Lus10002567 59 / 8e-12 AT1G63060 89 / 3e-24 unknown protein
Lus10001796 57 / 3e-11 AT1G63060 87 / 2e-23 unknown protein
Lus10000001 46 / 3e-07 AT1G63060 71 / 1e-17 unknown protein
PFAM info
Representative CDS sequence
>Potri.012G111000.2 pacid=42784216 polypeptide=Potri.012G111000.2.p locus=Potri.012G111000 ID=Potri.012G111000.2.v4.1 annot-version=v4.1
ATGGCTTTTAGATCAATGGGATATTGGAAATCAATAGCTAGTCGCTTAAGTGGAACAACAACCTATGCAACCTCAACCCCGCCAAAACTGAAATCATATG
CACCAACAGCTGATCAGTTTGGACATCACTATCATCAAGAAAGCAAGCATGGCAAGAAGGTGAGAGGTGACTTTGTGCCAGTTTATGTGGCAATAGGGAT
GATAGCTGTATCAATATCACTTGGTCTTTACACTGCCAAGCAACAAGTACTGTATGCACCTAATGTTCGCGTAAGGAAGAAGACTAGAGAGACCATACCT
GAAGTGGTTGATCCAGATAAAGTGGTGGATGAAGCTGATAAGTTCATAAAGAAATCATTTTTCAGGAAAGTAGCACATGTTCAAGAGTTTGATCATTATG
GACTTGAGTATTTGCCTGATCCTGCTCGTAAAGATGCTTTTGCACGTAAGCCTCGTGCTGAGACCCTTAAAGATGTAGGGGTCGATCCTAAACTACAGCT
TTGA
AA sequence
>Potri.012G111000.2 pacid=42784216 polypeptide=Potri.012G111000.2.p locus=Potri.012G111000 ID=Potri.012G111000.2.v4.1 annot-version=v4.1
MAFRSMGYWKSIASRLSGTTTYATSTPPKLKSYAPTADQFGHHYHQESKHGKKVRGDFVPVYVAIGMIAVSISLGLYTAKQQVLYAPNVRVRKKTRETIP
EVVDPDKVVDEADKFIKKSFFRKVAHVQEFDHYGLEYLPDPARKDAFARKPRAETLKDVGVDPKLQL

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G07330 unknown protein Potri.012G111000 0 1
AT3G07150 unknown protein Potri.002G244400 2.00 0.9363
AT1G66510 AAR2 protein family (.1.2.3) Potri.017G123900 3.00 0.9316
AT5G53400 BOB1, BOBBER1 BOBBER1, HSP20-like chaperones... Potri.015G013900 5.29 0.8942
AT1G53540 HSP20-like chaperones superfam... Potri.010G175200 5.91 0.9059 Pt-HSP17.8
AT4G03320 AtTic20-IV, TIC... translocon at the inner envelo... Potri.019G108800 7.21 0.9213
Potri.001G443150 15.62 0.7999
AT3G44110 ATJ3 DNAJ homologue 3 (.1.2) Potri.009G015700 16.06 0.9059 Pt-PM37.1
AT1G56170 CCAAT NF-YC2, ATHAP5B... "nuclear factor Y, subunit C2"... Potri.007G070900 20.37 0.8344
AT5G52640 AtHsp90-1, ATHS... HEAT SHOCK PROTEIN 83, HEAT SH... Potri.017G146600 22.27 0.9054
Potri.001G054850 22.58 0.7708

Potri.012G111000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.