Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G61750 201 / 2e-65 RmlC-like cupins superfamily protein (.1) AT1G10460 136 / 5e-40 GLP7 germin-like protein 7 (.1) AT3G04190 134 / 3e-39 RmlC-like cupins superfamily protein (.1) AT1G18970 134 / 5e-39 GLP4 germin-like protein 4 (.1) AT5G38910 134 / 7e-39 RmlC-like cupins superfamily protein (.1) AT3G04150 134 / 8e-39 RmlC-like cupins superfamily protein (.1.2) AT5G39150 132 / 4e-38 RmlC-like cupins superfamily protein (.1) AT5G39180 131 / 5e-38 RmlC-like cupins superfamily protein (.1) AT5G39160 131 / 6e-38 RmlC-like cupins superfamily protein (.1.2.3) AT3G04200 131 / 9e-38 RmlC-like cupins superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G109600 [exp] 326 / 1e-114 AT5G61750 225 / 6e-75 RmlC-like cupins superfamily protein (.1) Potri.009G140400 [exp] 144 / 1e-42 AT5G39110 247 / 3e-83 RmlC-like cupins superfamily protein (.1) Potri.009G140350 [exp] 142 / 2e-42 AT5G39110 249 / 3e-84 RmlC-like cupins superfamily protein (.1) Potri.013G051700 [exp] 141 / 1e-41 AT3G05950 298 / 2e-103 RmlC-like cupins superfamily protein (.1) Potri.013G051600 [exp] 140 / 2e-41 AT3G05950 296 / 1e-102 RmlC-like cupins superfamily protein (.1) Potri.013G064100 [exp] 139 / 7e-41 AT5G39130 282 / 5e-97 RmlC-like cupins superfamily protein (.1) Potri.013G063050 [exp] 139 / 8e-41 AT5G39130 281 / 1e-96 RmlC-like cupins superfamily protein (.1) Potri.013G062950 [exp] 139 / 8e-41 AT5G39130 284 / 6e-98 RmlC-like cupins superfamily protein (.1) Potri.013G063100 [exp] 139 / 8e-41 AT5G39130 284 / 6e-98 RmlC-like cupins superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10022071 [exp] 252 / 3e-85 AT5G61750 222 / 2e-73 RmlC-like cupins superfamily protein (.1) Lus10042616 [exp] 226 / 7e-75 AT5G61750 226 / 3e-75 RmlC-like cupins superfamily protein (.1) Lus10035280 [exp] 149 / 4e-45 AT3G05950 252 / 2e-85 RmlC-like cupins superfamily protein (.1) Lus10035279 [exp] 144 / 9e-43 AT5G39160 244 / 2e-82 RmlC-like cupins superfamily protein (.1.2.3) Lus10030048 [exp] 144 / 1e-42 AT3G05950 249 / 3e-84 RmlC-like cupins superfamily protein (.1) Lus10029010 [exp] 142 / 6e-42 AT3G05950 250 / 2e-84 RmlC-like cupins superfamily protein (.1) Lus10035278 [exp] 141 / 8e-42 AT3G05950 254 / 3e-86 RmlC-like cupins superfamily protein (.1) Lus10030047 [exp] 141 / 1e-41 AT3G05950 256 / 7e-87 RmlC-like cupins superfamily protein (.1) Lus10026962 [exp] 137 / 3e-40 AT3G05950 251 / 6e-85 RmlC-like cupins superfamily protein (.1) Lus10021980 [exp] 137 / 6e-40 AT5G39160 249 / 5e-84 RmlC-like cupins superfamily protein (.1.2.3)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0029 [poplar] [flax] Cupin PF07883 [poplar] [flax] Cupin_2 Cupin domain
Representative CDS sequence Show only first row Show all	>Potri.012G111500.1 pacid=42783645 polypeptide=Potri.012G111500.1.p locus=Potri.012G111500 ID=Potri.012G111500.1.v4.1 annot-version=v4.1 ATGAAATTCACACTTTTCTTCTGCATTTTCCTGTGCCCTTGCATCACTATCTGCTTGGCAGATAGCGATAATCTTCAGGATACTTGCCCAACAGCTACTA TAGGCATGCAAACTGTCTTCATCAATGGCTTCCCTTGCAAGAACCCAAACAGCGTCGTTGCTTCAGATTTCAAGTCATCAAAACTGAGTCATCCTGGTGA CACAGGCACTTTCTTCCGTTCATCACTTACCCTTGACATGGCTGCGGATTTCCCAGGTCTCAACACTCTCGGCCTCTCAATAGCTAGGACTGACCTTGAA GTTGAAGGTTTGACCATGCCCCATTCCCATCCAAGAGCATCGGAGATATTCTTCGTTAGCACAGGTGTGGTGTTTGCTGGCTTTTTCGACACTCAAAGCA AACTGTTCTCAAAAATTCTCAAGCCAGGAGAAGTTTTTGTGGTTCCTCAAGGTCTGCTCCACTTTTTCATCAATACTGGCGATGAGGCTGCAGTTATTTT CTCTGTACTTAATAGCCAGAACCCAGGGGTGGTAAAGATTTCCGGTGCATCGTTTGAGCCTGATGATGAGGAAATGGTAGATAAACTAGTAAGGAAAATA AAATCTGCTGCTGCCTTGGAGGGCAAAGCATCTAGCATTCAGAATGTGACTCCGACTGACTTTTAA
AA sequence Show only first row Show all	>Potri.012G111500.1 pacid=42783645 polypeptide=Potri.012G111500.1.p locus=Potri.012G111500 ID=Potri.012G111500.1.v4.1 annot-version=v4.1 MKFTLFFCIFLCPCITICLADSDNLQDTCPTATIGMQTVFINGFPCKNPNSVVASDFKSSKLSHPGDTGTFFRSSLTLDMAADFPGLNTLGLSIARTDLE VEGLTMPHSHPRASEIFFVSTGVVFAGFFDTQSKLFSKILKPGEVFVVPQGLLHFFINTGDEAAVIFSVLNSQNPGVVKISGASFEPDDEEMVDKLVRKI KSAAALEGKASSIQNVTPTDF

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G61750			RmlC-like cupins superfamily p...		Potri.012G111500 [exp]	0	1
AT1G20850		XCP2	xylem cysteine peptidase 2 (.1...		Potri.005G256000 [exp]	1.00	0.9503	XCP2.1
AT1G10460		GLP7	germin-like protein 7 (.1)		Potri.010G038200 [exp]	2.23	0.9027
AT3G49070			Protein of unknown function (D...		Potri.015G147400 [exp]	2.44	0.9131
AT5G01930		MAN6, AtMAN6	endo-beta-mannase 6, Glycosyl ...		Potri.006G109900 [exp]	2.44	0.9146
AT5G61750			RmlC-like cupins superfamily p...		Potri.015G109600 [exp]	3.46	0.9128
AT3G13650			Disease resistance-responsive ...		Potri.001G023800 [exp]	3.60	0.8557
AT1G58370		ATXYN1, RXF12	ARABIDOPSIS THALIANA XYLANASE ...		Potri.002G113132 [exp]	4.89	0.9007
AT1G29050		TBL38	TRICHOME BIREFRINGENCE-LIKE 38...		Potri.011G106200 [exp]	5.83	0.8457
AT1G26820		RNS3	ribonuclease 3 (.1)		Potri.008G086800 [exp]	6.48	0.8839	S.4
AT1G79450		ALIS5	ALA-interacting subunit 5 (.1....		Potri.001G381500 [exp]	6.48	0.8528

Compare expression of checked genes

Potri.012G111500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.