Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G51100 221 / 1e-72 FSD2 Fe superoxide dismutase 2 (.1) AT4G25100 179 / 2e-57 ATFSD1, FSD1 ARABIDOPSIS FE SUPEROXIDE DISMUTASE 1, Fe superoxide dismutase 1 (.1.2.3.4.5) AT5G23310 164 / 1e-50 FSD3 Fe superoxide dismutase 3 (.1) AT3G10920 69 / 2e-14 MSD1, MEE33, ATMSD1 MATERNAL EFFECT EMBRYO ARREST 33, ARABIDOPSIS MANGANESE SUPEROXIDE DISMUTASE 1, manganese superoxide dismutase 1 (.1.2) AT3G56350 65 / 6e-13 Iron/manganese superoxide dismutase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G110400 [exp] 257 / 1e-86 AT5G51100 335 / 3e-115 Fe superoxide dismutase 2 (.1) Potri.005G089600 [exp] 149 / 1e-44 AT5G23310 340 / 1e-118 Fe superoxide dismutase 3 (.1) Potri.013G092600 [exp] 69 / 2e-14 AT3G10920 370 / 6e-132 MATERNAL EFFECT EMBRYO ARREST 33, ARABIDOPSIS MANGANESE SUPEROXIDE DISMUTASE 1, manganese superoxide dismutase 1 (.1.2) Potri.019G057300 [exp] 66 / 4e-13 AT3G10920 360 / 6e-128 MATERNAL EFFECT EMBRYO ARREST 33, ARABIDOPSIS MANGANESE SUPEROXIDE DISMUTASE 1, manganese superoxide dismutase 1 (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10026881 [exp] 226 / 4e-74 AT5G51100 373 / 3e-130 Fe superoxide dismutase 2 (.1) Lus10017378 [exp] 169 / 7e-52 AT5G23310 368 / 5e-129 Fe superoxide dismutase 3 (.1) Lus10010174 [exp] 163 / 9e-50 AT5G23310 359 / 1e-125 Fe superoxide dismutase 3 (.1) Lus10034222 [exp] 69 / 3e-14 AT3G10920 370 / 2e-131 MATERNAL EFFECT EMBRYO ARREST 33, ARABIDOPSIS MANGANESE SUPEROXIDE DISMUTASE 1, manganese superoxide dismutase 1 (.1.2) Lus10012883 [exp] 69 / 8e-14 AT3G10920 356 / 1e-123 MATERNAL EFFECT EMBRYO ARREST 33, ARABIDOPSIS MANGANESE SUPEROXIDE DISMUTASE 1, manganese superoxide dismutase 1 (.1.2) Lus10030534 [exp] 57 / 6e-10 AT3G10920 241 / 8e-81 MATERNAL EFFECT EMBRYO ARREST 33, ARABIDOPSIS MANGANESE SUPEROXIDE DISMUTASE 1, manganese superoxide dismutase 1 (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00081 [poplar] [flax] Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain PF02777 [poplar] [flax] Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Representative CDS sequence Show only first row Show all	>Potri.012G112301.2 pacid=42784002 polypeptide=Potri.012G112301.2.p locus=Potri.012G112301 ID=Potri.012G112301.2.v4.1 annot-version=v4.1 ATGTTTTTCTTACCTTCACTCTCTTTTTTCTTTCTTCATCCGACTCAGTGTTTTCTTGCATTTCAGGTCTTACAGCAACTGGTGTGCTGCGATGGACAGA GGGTTGCCAGTATTACACGTTCGAGGCAATGTACCAGAAAGGCTGATGCTTTGACAGTTACAGCTAAATTTGAGCTGAAACCTCCTCCATATCCCATGGA TGATTTAGAGCCGCATATGAGCAAGGACACATTTGAGTATCACCGGGGAAAGCATCACAGGGCTTATGTGGATAACTTAAACAAGCAAATTGACGGAACA GAACGAGATGACATGTCCTTAGATGATGTTGTGCTCGTTACATACAACAAGGGTGGTCCACTTCCTGCTTTCAACAATGCTGCACAGGCATGGAACCATG AATTCTTTTTGGAATCCATGAAACCGGGAGGTGGAGGAAAGGCATCAGGGGAACTTCTTCACTTGATTGAAAGAGATTTTGGTTCTTTTGATAGATTTGT GCAAGAGTTCAAGTCGGCTGCAGCTACTCAGTTTGGTTCTGGATGGGCTTGGCTTGTTTCCACTCCATACAATTGA
AA sequence Show only first row Show all	>Potri.012G112301.2 pacid=42784002 polypeptide=Potri.012G112301.2.p locus=Potri.012G112301 ID=Potri.012G112301.2.v4.1 annot-version=v4.1 MFFLPSLSFFFLHPTQCFLAFQVLQQLVCCDGQRVASITRSRQCTRKADALTVTAKFELKPPPYPMDDLEPHMSKDTFEYHRGKHHRAYVDNLNKQIDGT ERDDMSLDDVVLVTYNKGGPLPAFNNAAQAWNHEFFLESMKPGGGGKASGELLHLIERDFGSFDRFVQEFKSAAATQFGSGWAWLVSTPYN

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G51100		FSD2	Fe superoxide dismutase 2 (.1)		Potri.012G112301 [exp]	0	1
AT1G29260		PEX7, ATPEX7	ARABIDOPSIS PEROXIN 7, peroxin...		Potri.011G066600 [exp]	3.16	0.7416
AT1G23360		MENG	S-adenosyl-L-methionine-depend...		Potri.008G188600 [exp]	4.58	0.7142
AT1G17330			Metal-dependent phosphohydrola...		Potri.007G072000 [exp]	6.32	0.7012
AT1G18870		ATICS2, ICS2	ARABIDOPSIS ISOCHORISMATE SYNT...		Potri.012G070000 [exp]	13.92	0.7612
AT1G66520		PDE194	pigment defective 194, formylt...		Potri.017G123300 [exp]	20.12	0.6898
AT4G22910		CCS52A1, FZR2	cell cycle switch protein 52 ...		Potri.003G119500 [exp]	28.14	0.6526	Pt-CCS52.1
AT1G69600	ZF_HD	ATHB29, ZFHD1, ...	ZINC FINGER HOMEODOMAIN 11, AR...		Potri.010G169400 [exp]	29.69	0.6803
					Potri.003G044301 [exp]	42.24	0.6960
AT1G49180			protein kinase family protein ...		Potri.019G007200 [exp]	43.81	0.6834
AT1G30520		AAE14	acyl-activating enzyme 14 (.1)		Potri.011G164100 [exp]	59.69	0.6849

Compare expression of checked genes

Potri.012G112301 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.