Potri.012G114600 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G44740 277 / 3e-95 CYCP4;1 cyclin p4;1 (.1)
AT5G07450 222 / 2e-73 CYCP4;3 cyclin p4;3 (.1)
AT5G61650 222 / 2e-73 CYCP4;2 CYCLIN P4;2 (.1)
AT2G45080 152 / 5e-46 CYCP3;1 cyclin p3;1 (.1)
AT3G21870 149 / 4e-45 CYCP2;1 cyclin p2;1 (.1)
AT3G60550 147 / 9e-44 CYCP3;2 cyclin p3;2 (.1)
AT3G63120 145 / 2e-43 CYCP1;1 cyclin p1;1 (.1)
AT3G05327 142 / 3e-42 Cyclin family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.015G112140 379 / 1e-135 AT2G44740 274 / 1e-94 cyclin p4;1 (.1)
Potri.014G050400 318 / 8e-112 AT2G44740 285 / 8e-99 cyclin p4;1 (.1)
Potri.002G052800 175 / 2e-54 AT3G63120 219 / 1e-71 cyclin p1;1 (.1)
Potri.005G209800 170 / 4e-53 AT3G63120 223 / 7e-74 cyclin p1;1 (.1)
Potri.007G121500 170 / 7e-53 AT3G21870 228 / 5e-76 cyclin p2;1 (.1)
Potri.013G023000 156 / 5e-48 AT3G05327 194 / 4e-63 Cyclin family protein (.1)
Potri.005G033600 150 / 1e-45 AT3G05327 184 / 5e-59 Cyclin family protein (.1)
Potri.002G143400 151 / 2e-45 AT2G45080 324 / 1e-113 cyclin p3;1 (.1)
Potri.014G066400 145 / 2e-43 AT3G60550 343 / 3e-121 cyclin p3;2 (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10032505 242 / 5e-81 AT2G44740 228 / 7e-76 cyclin p4;1 (.1)
Lus10043003 239 / 5e-80 AT2G44740 227 / 2e-75 cyclin p4;1 (.1)
Lus10004475 175 / 5e-55 AT3G05327 171 / 1e-53 Cyclin family protein (.1)
Lus10029933 174 / 1e-54 AT3G05327 172 / 3e-54 Cyclin family protein (.1)
Lus10022038 173 / 5e-54 AT3G63120 197 / 8e-64 cyclin p1;1 (.1)
Lus10042582 172 / 8e-54 AT3G63120 191 / 2e-61 cyclin p1;1 (.1)
Lus10039697 164 / 1e-50 AT3G21870 236 / 3e-79 cyclin p2;1 (.1)
Lus10027148 163 / 1e-49 AT3G21870 233 / 6e-77 cyclin p2;1 (.1)
Lus10042873 150 / 7e-45 AT3G60550 300 / 8e-104 cyclin p3;2 (.1)
Lus10028174 141 / 5e-42 AT2G45080 249 / 1e-84 cyclin p3;1 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0065 Cyclin PF00134 Cyclin_N Cyclin, N-terminal domain
Representative CDS sequence
>Potri.012G114600.1 pacid=42782582 polypeptide=Potri.012G114600.1.p locus=Potri.012G114600 ID=Potri.012G114600.1.v4.1 annot-version=v4.1
ATGCAAAAGGAAGGCAGGAGGTGTCTTATAAACACAGCTAGCACACAACAAACCAAAGTAAACCAAACAAGAATGGCAGAATTAGCAGAGACCACAGTGA
TGCCTAAGGTCATTACTTTCCTCTCTTCTCTTCTTCAAAGGGTAGCAGAGTCTAATGATCTTAGCCAACAATTATACCCCCAGAAAGTCTCGATCTTTCA
TGGCCTTTCTAGACCTCCTATATCCATTCAAAACTATCTTGAAAGAATCTTCAAGTATGCAAATTGTAGTCCCTCTTGTTTTGTTGTTGCTTATGTGTAT
CTTGATCGGTTTGCTCAGAGACAATCCTGTTTTCCTATCAATTCATTCAACGTGCATAGACTGCTTATCACAAGTGTCTTGATCTCTGTCAAGTTCATGG
ATGATATATATTACAATAATGCCTTCTATGCTAAAGTTGGAGGAATCAGCACCGCAGAGATGAATCTTCTTGAAGTGGATTTTTTATTTGGTTTAGGCTT
CCAATTGAATGTGACACCCACCATGTTCCACGCTTACTGCTCCTACCTTCAAAGAGAGATGTTGATTCAATCTCCTCTACCGATTGTAGACCTTCCTCTA
AATATGGCTAGACTACAAAAAACCCATTGCTGTTTCAACGAAGATGAATCCACTCATCAAAAACAGCTTGCTGTTTAG
AA sequence
>Potri.012G114600.1 pacid=42782582 polypeptide=Potri.012G114600.1.p locus=Potri.012G114600 ID=Potri.012G114600.1.v4.1 annot-version=v4.1
MQKEGRRCLINTASTQQTKVNQTRMAELAETTVMPKVITFLSSLLQRVAESNDLSQQLYPQKVSIFHGLSRPPISIQNYLERIFKYANCSPSCFVVAYVY
LDRFAQRQSCFPINSFNVHRLLITSVLISVKFMDDIYYNNAFYAKVGGISTAEMNLLEVDFLFGLGFQLNVTPTMFHAYCSYLQREMLIQSPLPIVDLPL
NMARLQKTHCCFNEDESTHQKQLAV

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT2G44740 CYCP4;1 cyclin p4;1 (.1) Potri.012G114600 0 1
AT5G37478 TPX2 (targeting protein for Xk... Potri.017G144061 1.41 0.9417
AT1G10200 LIM WLIM1, SF3 WLIM1, GATA type zinc finger t... Potri.014G015600 3.87 0.9081
AT5G21070 unknown protein Potri.004G196600 4.00 0.9420
AT1G16860 Ubiquitin-specific protease fa... Potri.008G006100 4.89 0.9108
AT5G23860 TUB8, b-TUB tubulin beta 8 (.1.2) Potri.011G162500 5.09 0.9085 Pt-TUB4.1
AT1G63430 Leucine-rich repeat protein ki... Potri.003G124800 5.47 0.9336
AT5G05570 transducin family protein / WD... Potri.008G069700 7.41 0.9109
AT5G24170 Got1/Sft2-like vescicle transp... Potri.012G012700 7.74 0.9038
AT2G35110 NAPP, GRL, NAP1 NCK-ASSOCIATED PROTEIN 1, GNAR... Potri.015G123900 8.00 0.8983
AT2G40435 unknown protein Potri.006G106900 8.83 0.8799

Potri.012G114600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.