Potri.012G116090 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G45160 136 / 8e-39 Root hair defective 3 GTP-binding protein (RHD3) (.1)
AT3G13870 128 / 9e-36 GOM8, RHD3 GOLGI MUTANT 8, Root hair defective 3 GTP-binding protein (RHD3) (.1), Root hair defective 3 GTP-binding protein (RHD3) (.2)
AT1G72960 123 / 5e-34 Root hair defective 3 GTP-binding protein (RHD3) (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.012G116210 209 / 2e-65 AT5G45160 719 / 0.0 Root hair defective 3 GTP-binding protein (RHD3) (.1)
Potri.012G116700 206 / 2e-64 AT5G45160 727 / 0.0 Root hair defective 3 GTP-binding protein (RHD3) (.1)
Potri.012G117300 204 / 8e-64 AT5G45160 620 / 0.0 Root hair defective 3 GTP-binding protein (RHD3) (.1)
Potri.012G116130 174 / 3e-52 AT5G45160 707 / 0.0 Root hair defective 3 GTP-binding protein (RHD3) (.1)
Potri.012G116000 174 / 3e-52 AT5G45160 671 / 0.0 Root hair defective 3 GTP-binding protein (RHD3) (.1)
Potri.015G112600 153 / 1e-44 AT5G45160 717 / 0.0 Root hair defective 3 GTP-binding protein (RHD3) (.1)
Potri.015G112700 142 / 6e-41 AT5G45160 1161 / 0.0 Root hair defective 3 GTP-binding protein (RHD3) (.1)
Potri.012G117034 117 / 9e-36 AT5G45160 142 / 1e-40 Root hair defective 3 GTP-binding protein (RHD3) (.1)
Potri.001G201000 124 / 2e-34 AT1G72960 1204 / 0.0 Root hair defective 3 GTP-binding protein (RHD3) (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10036197 140 / 2e-44 AT5G45160 239 / 2e-75 Root hair defective 3 GTP-binding protein (RHD3) (.1)
Lus10036195 142 / 1e-40 AT5G45160 1216 / 0.0 Root hair defective 3 GTP-binding protein (RHD3) (.1)
Lus10018282 140 / 4e-40 AT5G45160 1055 / 0.0 Root hair defective 3 GTP-binding protein (RHD3) (.1)
Lus10040630 139 / 1e-39 AT5G45160 1221 / 0.0 Root hair defective 3 GTP-binding protein (RHD3) (.1)
Lus10038333 137 / 7e-39 AT5G45160 1217 / 0.0 Root hair defective 3 GTP-binding protein (RHD3) (.1)
Lus10037641 88 / 1e-21 AT1G72960 1108 / 0.0 Root hair defective 3 GTP-binding protein (RHD3) (.1)
Lus10015623 50 / 4e-08 AT1G72970 777 / 0.0 HOTHEAD, embryo sac development arrest 17, Glucose-methanol-choline (GMC) oxidoreductase family protein (.1), Glucose-methanol-choline (GMC) oxidoreductase family protein (.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0023 P-loop_NTPase PF05879 RHD3 Root hair defective 3 GTP-binding protein (RHD3)
Representative CDS sequence
>Potri.012G116090.1 pacid=42784164 polypeptide=Potri.012G116090.1.p locus=Potri.012G116090 ID=Potri.012G116090.1.v4.1 annot-version=v4.1
ATGAAAATGGAGCAAGGCATGCAGCTGATTGATGGAAATGGCAAGTTCAACGTGGATGGACTCAAAGACTTCATGACAGCCACCGAGTTCGCTCAGTCCG
GTCTCTCCTATGCTATTGTTGCCATCATTGGCTCACAGAGTAGCGGGAAAAGCACCCTAATGAATCAGACCTTCCATACCAATTTCGAGGAGATGGATGC
ATACAATGGAAGAGGTCAAACAACCAAGGGCATTTGGATTGCAAAGTGTAGTGATATTGACCCTTTTACGATTGCCATGGATTTCGAGGGAACGGACTGT
TAA
AA sequence
>Potri.012G116090.1 pacid=42784164 polypeptide=Potri.012G116090.1.p locus=Potri.012G116090 ID=Potri.012G116090.1.v4.1 annot-version=v4.1
MKMEQGMQLIDGNGKFNVDGLKDFMTATEFAQSGLSYAIVAIIGSQSSGKSTLMNQTFHTNFEEMDAYNGRGQTTKGIWIAKCSDIDPFTIAMDFEGTDC

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G45160 Root hair defective 3 GTP-bind... Potri.012G116090 0 1
AT3G50950 ZAR1 HOPZ-ACTIVATED RESISTANCE 1 (.... Potri.016G092600 2.82 0.8751
AT3G60320 Protein of unknown function (D... Potri.014G047400 3.16 0.8545
AT3G48770 DNA binding;ATP binding (.1) Potri.012G103700 5.74 0.8297
AT1G06490 CalS7, ATGSL7, ... callose synthase 7, Arabidopsi... Potri.005G203500 8.83 0.8678 ATGSL11.1
AT1G53440 Leucine-rich repeat transmembr... Potri.016G011200 11.22 0.8326
AT1G65810 P-loop containing nucleoside t... Potri.004G077500 13.07 0.8653
AT1G72210 bHLH bHLH096 basic helix-loop-helix (bHLH) ... Potri.005G071100 25.03 0.8125
AT5G45160 Root hair defective 3 GTP-bind... Potri.012G116130 26.55 0.8236
AT5G62670 AHA11 H\(+\)-ATPase 11, H\(+\)-ATPas... Potri.015G066000 27.71 0.8176 HA2.2
AT2G19480 NFA2, NFA02, NA... NUCLEOSOME/CHROMATIN ASSEMBLY ... Potri.003G036200 27.82 0.8423

Potri.012G116090 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.