Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G45160 240 / 6e-75 Root hair defective 3 GTP-binding protein (RHD3) (.1) AT3G13870 230 / 1e-71 GOM8, RHD3 GOLGI MUTANT 8, Root hair defective 3 GTP-binding protein (RHD3) (.1), Root hair defective 3 GTP-binding protein (RHD3) (.2) AT1G72960 226 / 4e-70 Root hair defective 3 GTP-binding protein (RHD3) (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G117100 [exp] 253 / 9e-83 AT5G45160 507 / 3e-172 Root hair defective 3 GTP-binding protein (RHD3) (.1) Potri.015G112700 [exp] 251 / 2e-79 AT5G45160 1161 / 0.0 Root hair defective 3 GTP-binding protein (RHD3) (.1) Potri.001G201000 [exp] 228 / 1e-70 AT1G72960 1204 / 0.0 Root hair defective 3 GTP-binding protein (RHD3) (.1) Potri.003G038900 [exp] 223 / 1e-68 AT3G13870 1220 / 0.0 GOLGI MUTANT 8, Root hair defective 3 GTP-binding protein (RHD3) (.1), Root hair defective 3 GTP-binding protein (RHD3) (.2) Potri.012G116130 [exp] 209 / 5e-64 AT5G45160 707 / 0.0 Root hair defective 3 GTP-binding protein (RHD3) (.1) Potri.012G116700 [exp] 209 / 5e-64 AT5G45160 727 / 0.0 Root hair defective 3 GTP-binding protein (RHD3) (.1) Potri.015G112600 [exp] 209 / 6e-64 AT5G45160 717 / 0.0 Root hair defective 3 GTP-binding protein (RHD3) (.1) Potri.012G116210 [exp] 206 / 3e-63 AT5G45160 719 / 0.0 Root hair defective 3 GTP-binding protein (RHD3) (.1) Potri.012G117300 [exp] 202 / 9e-62 AT5G45160 620 / 0.0 Root hair defective 3 GTP-binding protein (RHD3) (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10018282 [exp] 242 / 1e-76 AT5G45160 1055 / 0.0 Root hair defective 3 GTP-binding protein (RHD3) (.1) Lus10036195 [exp] 242 / 8e-76 AT5G45160 1216 / 0.0 Root hair defective 3 GTP-binding protein (RHD3) (.1) Lus10038333 [exp] 241 / 2e-75 AT5G45160 1217 / 0.0 Root hair defective 3 GTP-binding protein (RHD3) (.1) Lus10040630 [exp] 240 / 4e-75 AT5G45160 1221 / 0.0 Root hair defective 3 GTP-binding protein (RHD3) (.1) Lus10036197 [exp] 186 / 4e-61 AT5G45160 239 / 2e-75 Root hair defective 3 GTP-binding protein (RHD3) (.1) Lus10037641 [exp] 192 / 2e-57 AT1G72960 1108 / 0.0 Root hair defective 3 GTP-binding protein (RHD3) (.1) Lus10015623 [exp] 150 / 3e-42 AT1G72970 777 / 0.0 HOTHEAD, embryo sac development arrest 17, Glucose-methanol-choline (GMC) oxidoreductase family protein (.1), Glucose-methanol-choline (GMC) oxidoreductase family protein (.2) Lus10024841 [exp] 41 / 0.0003 AT2G38840 976 / 0.0 Guanylate-binding family protein (.1) Lus10018755 [exp] 40 / 0.0006 AT2G38840 989 / 0.0 Guanylate-binding family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0023 [poplar] [flax] P-loop_NTPase PF05879 [poplar] [flax] RHD3 Root hair defective 3 GTP-binding protein (RHD3)
Representative CDS sequence Show only first row Show all	>Potri.012G117001.1 pacid=42783683 polypeptide=Potri.012G117001.1.p locus=Potri.012G117001 ID=Potri.012G117001.1.v4.1 annot-version=v4.1 ATGGCGGAAGATTGTTTCCGCTTCCAACTGATTACCGGTGACGGTGTTTTAGACATGCAAGGACTCGAAAACTTCACGAGGACCACCAACCTCTCACAAC GCGGTGTCTCCTATGCTGTTGTTGCAATTATGGGCCCCCAAAGTGGCGGGAAGAGCACCCTCTTGAACAAGCTCTTTCAGACAAATTTCAGGATGATGGA TGCAGAAGAAGGAAGGAGTCAAACAACTCAAGGCATTTGGATTGGGAAGGGTATTGGTATCGAGCCTTTCACAATTGCCATGGACGTGGAGGGATCGGAC AGCAGGGAAAGAGGCCAAGACGGCGCAACATTCGAAAAGCAAAGTGCTCTATTTGCTTTGGCAATTGCTGACATTGTAATGATAAACATGTGGTGCCATG ACATTGGTCGAGAACATGCTGCCAACAGACCCCTTTTGAAAACAGTTTTTGAGGCCATGACTCGTCTCTTTCGCGCCCGCAAAACAACCCGTAGTTTGTC CTCCGTGACCACACCAAGACTCCACTTGAACGTCTAG
AA sequence Show only first row Show all	>Potri.012G117001.1 pacid=42783683 polypeptide=Potri.012G117001.1.p locus=Potri.012G117001 ID=Potri.012G117001.1.v4.1 annot-version=v4.1 MAEDCFRFQLITGDGVLDMQGLENFTRTTNLSQRGVSYAVVAIMGPQSGGKSTLLNKLFQTNFRMMDAEEGRSQTTQGIWIGKGIGIEPFTIAMDVEGSD SRERGQDGATFEKQSALFALAIADIVMINMWCHDIGREHAANRPLLKTVFEAMTRLFRARKTTRSLSSVTTPRLHLNV

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G45160			Root hair defective 3 GTP-bind...		Potri.012G117001 [exp]	0	1
AT5G45160			Root hair defective 3 GTP-bind...		Potri.012G116900 [exp]	1.00	0.9779
					Potri.019G002400 [exp]	2.00	0.9469
AT5G59100			Subtilisin-like serine endopep...		Potri.010G196700 [exp]	2.44	0.9584
AT1G06620			2-oxoglutarate (2OG) and Fe(II...		Potri.010G073232 [exp]	3.00	0.9266
					Potri.013G045700 [exp]	4.24	0.9405
AT3G21360			2-oxoglutarate (2OG) and Fe(II...		Potri.010G131200 [exp]	5.91	0.9376
AT5G52390			PAR1 protein (.1)		Potri.009G040000 [exp]	6.70	0.9438
AT4G13010			Oxidoreductase, zinc-binding d...		Potri.001G452600 [exp]	10.58	0.9082
AT5G06720		ATPA2	peroxidase 2 (.1)		Potri.016G058200 [exp]	10.95	0.9232	HPOX14.2
AT4G00820		IQD17	IQ-domain 17 (.1)		Potri.014G104600 [exp]	11.74	0.8485

Compare expression of checked genes

Potri.012G117001 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.