Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G45160 142 / 2e-40 Root hair defective 3 GTP-binding protein (RHD3) (.1) AT1G72960 129 / 6e-36 Root hair defective 3 GTP-binding protein (RHD3) (.1) AT3G13870 124 / 2e-34 GOM8, RHD3 GOLGI MUTANT 8, Root hair defective 3 GTP-binding protein (RHD3) (.1), Root hair defective 3 GTP-binding protein (RHD3) (.2) AT2G38840 39 / 0.0004 Guanylate-binding family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G117100 [exp] 176 / 3e-54 AT5G45160 507 / 3e-172 Root hair defective 3 GTP-binding protein (RHD3) (.1) Potri.012G117001 [exp] 156 / 4e-50 AT5G45160 242 / 1e-75 Root hair defective 3 GTP-binding protein (RHD3) (.1) Potri.015G112700 [exp] 143 / 5e-41 AT5G45160 1161 / 0.0 Root hair defective 3 GTP-binding protein (RHD3) (.1) Potri.012G116090 [exp] 117 / 8e-36 AT5G45160 137 / 6e-39 Root hair defective 3 GTP-binding protein (RHD3) (.1) Potri.015G112600 [exp] 128 / 9e-36 AT5G45160 717 / 0.0 Root hair defective 3 GTP-binding protein (RHD3) (.1) Potri.001G201000 [exp] 126 / 4e-35 AT1G72960 1204 / 0.0 Root hair defective 3 GTP-binding protein (RHD3) (.1) Potri.012G116210 [exp] 125 / 1e-34 AT5G45160 719 / 0.0 Root hair defective 3 GTP-binding protein (RHD3) (.1) Potri.012G117300 [exp] 124 / 2e-34 AT5G45160 620 / 0.0 Root hair defective 3 GTP-binding protein (RHD3) (.1) Potri.012G116700 [exp] 124 / 2e-34 AT5G45160 727 / 0.0 Root hair defective 3 GTP-binding protein (RHD3) (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10036197 [exp] 145 / 3e-46 AT5G45160 239 / 2e-75 Root hair defective 3 GTP-binding protein (RHD3) (.1) Lus10018282 [exp] 145 / 1e-41 AT5G45160 1055 / 0.0 Root hair defective 3 GTP-binding protein (RHD3) (.1) Lus10040630 [exp] 143 / 7e-41 AT5G45160 1221 / 0.0 Root hair defective 3 GTP-binding protein (RHD3) (.1) Lus10036195 [exp] 142 / 2e-40 AT5G45160 1216 / 0.0 Root hair defective 3 GTP-binding protein (RHD3) (.1) Lus10038333 [exp] 141 / 3e-40 AT5G45160 1217 / 0.0 Root hair defective 3 GTP-binding protein (RHD3) (.1) Lus10037641 [exp] 92 / 6e-23 AT1G72960 1108 / 0.0 Root hair defective 3 GTP-binding protein (RHD3) (.1) Lus10015623 [exp] 46 / 8e-07 AT1G72970 777 / 0.0 HOTHEAD, embryo sac development arrest 17, Glucose-methanol-choline (GMC) oxidoreductase family protein (.1), Glucose-methanol-choline (GMC) oxidoreductase family protein (.2) Lus10024841 [exp] 39 / 0.0002 AT2G38840 976 / 0.0 Guanylate-binding family protein (.1) Lus10018755 [exp] 39 / 0.0004 AT2G38840 989 / 0.0 Guanylate-binding family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0023 [poplar] [flax] P-loop_NTPase PF05879 [poplar] [flax] RHD3 Root hair defective 3 GTP-binding protein (RHD3)
Representative CDS sequence Show only first row Show all	>Potri.012G117034.1 pacid=42782709 polypeptide=Potri.012G117034.1.p locus=Potri.012G117034 ID=Potri.012G117034.1.v4.1 annot-version=v4.1 ATGGCGGAAGATTGTTGCAGCTTCCAACTCATTAGCGGTGACGGTGTCTTAAAAGTGAAAGGACTCGAAAACTTCACGAGGACCACGAACCTCGCACAGC GTCGTCTCTCCTATGCTGTTGTTGCAATTATTGGCCCCCAAAGCAGCGGGAAGAGCACGCTCTTGAATAAGCTCTTCCGGACAGATTTCTGGATGATGGA TGCACACGGAGGAAGGGGTCAAACAACCCAAGGCATTTGGATGGGGAAGGGTATTGGTATTGAGCCTTTCACAATTGCCATGGACGTGGAGGGATCGGAC AGCAGCGAAAGAGGCCAAGTACAAATTAATTAA
AA sequence Show only first row Show all	>Potri.012G117034.1 pacid=42782709 polypeptide=Potri.012G117034.1.p locus=Potri.012G117034 ID=Potri.012G117034.1.v4.1 annot-version=v4.1 MAEDCCSFQLISGDGVLKVKGLENFTRTTNLAQRRLSYAVVAIIGPQSSGKSTLLNKLFRTDFWMMDAHGGRGQTTQGIWMGKGIGIEPFTIAMDVEGSD SSERGQVQIN

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G45160			Root hair defective 3 GTP-bind...		Potri.012G117034 [exp]	0	1
AT1G73930			unknown protein		Potri.001G289250 [exp]	3.87	1.0000
					Potri.006G254450 [exp]	4.89	1.0000
AT5G57810		TET15	tetraspanin15 (.1)		Potri.018G100000 [exp]	6.00	1.0000
AT1G43760			DNAse I-like superfamily prote...		Potri.012G063901 [exp]	12.40	0.7323
AT5G03610			GDSL-like Lipase/Acylhydrolase...		Potri.005G053100 [exp]	12.40	0.6028
AT2G07020			Protein kinase protein with ad...		Potri.018G147032 [exp]	17.88	0.4907
AT2G37770		ChlAKR, AKR4C9	Chloroplastic aldo-keto reduct...		Potri.006G090501 [exp]	21.44	0.5493
					Potri.003G198150 [exp]	24.26	0.5038
					Potri.019G082300 [exp]	26.55	0.6004
AT2G14760	bHLH	bHLH084	basic helix-loop-helix (bHLH) ...		Potri.009G089000 [exp]	99.76	0.4492

Compare expression of checked genes

Potri.012G117034 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.