Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G13870 37 / 0.0005 GOM8, RHD3 GOLGI MUTANT 8, Root hair defective 3 GTP-binding protein (RHD3) (.1), Root hair defective 3 GTP-binding protein (RHD3) (.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G116170 [exp] 81 / 1e-19 AT5G45160 213 / 5e-62 Root hair defective 3 GTP-binding protein (RHD3) (.1) Potri.015G112700 [exp] 43 / 5e-06 AT5G45160 1161 / 0.0 Root hair defective 3 GTP-binding protein (RHD3) (.1) Potri.012G116900 [exp] 0 / 1 AT5G45160 124 / 3e-31 Root hair defective 3 GTP-binding protein (RHD3) (.1) Potri.012G117100 [exp] 0 / 1 AT5G45160 507 / 3e-172 Root hair defective 3 GTP-binding protein (RHD3) (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10036195 [exp] 43 / 4e-06 AT5G45160 1216 / 0.0 Root hair defective 3 GTP-binding protein (RHD3) (.1) Lus10038333 [exp] 43 / 5e-06 AT5G45160 1217 / 0.0 Root hair defective 3 GTP-binding protein (RHD3) (.1) Lus10040630 [exp] 41 / 2e-05 AT5G45160 1221 / 0.0 Root hair defective 3 GTP-binding protein (RHD3) (.1) Lus10018282 [exp] 37 / 0.0005 AT5G45160 1055 / 0.0 Root hair defective 3 GTP-binding protein (RHD3) (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.012G117067.1 pacid=42783308 polypeptide=Potri.012G117067.1.p locus=Potri.012G117067 ID=Potri.012G117067.1.v4.1 annot-version=v4.1 ATGTTGACATGCTGCGTCATCTACGTTCTAGTGCACTTAATATTTTTAAGACTAGGTTGGAAAAAAAAGGTGAAGGGGGCATCTACAGATGGATTTGAGG CTTCTATTGATCCTAGTGTTCAGCACGACGTGCGCAAATTTGAAAAAGGATGTAAAGATGTCTCCATAAGTAAGGAATGGGATGCTTCAGCAGTCAGGGA AAGTCTTCTTTTTGACATTGAGAAAACAAAATCCAAAACGAATTGA
AA sequence Show only first row Show all	>Potri.012G117067.1 pacid=42783308 polypeptide=Potri.012G117067.1.p locus=Potri.012G117067 ID=Potri.012G117067.1.v4.1 annot-version=v4.1 MLTCCVIYVLVHLIFLRLGWKKKVKGASTDGFEASIDPSVQHDVRKFEKGCKDVSISKEWDASAVRESLLFDIEKTKSKTN

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G45160			Root hair defective 3 GTP-bind...		Potri.012G117067 [exp]	0	1
					Potri.010G225900 [exp]	7.00	1.0000
					Potri.004G147966 [exp]	7.48	0.9950
AT1G03230			Eukaryotic aspartyl protease f...		Potri.019G064800 [exp]	8.77	0.9573
AT4G10270			Wound-responsive family protei...		Potri.013G148000 [exp]	9.00	0.9879
AT1G80440			Galactose oxidase/kelch repeat...		Potri.001G178300 [exp]	11.22	0.9499
					Potri.010G200150 [exp]	12.48	0.8963
AT1G58420			Uncharacterised conserved prot...		Potri.002G117100 [exp]	13.03	0.9243
AT1G03220			Eukaryotic aspartyl protease f...		Potri.019G065100 [exp]	13.96	0.9529
AT3G29970			B12D protein (.1)		Potri.004G117300 [exp]	16.24	0.9546
AT3G05550			Hypoxia-responsive family prot...		Potri.019G056000 [exp]	16.88	0.9357

Compare expression of checked genes

Potri.012G117067 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.