Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	ARA7.1
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G45130 369 / 4e-132 ATRAB-F2A, RHA1, AtRab5A, AtRABF2a ARABIDOPSIS RAB HOMOLOG F2A, RAB homolog 1 (.1) AT4G19640 365 / 2e-130 ATRAB-F2B, ARA7, Ara-7, AtRABF2b, AtRab5B ARABIDOPSIS RAB GTPASE HOMOLOG F2B, Ras-related small GTP-binding family protein (.1) AT3G54840 226 / 1e-75 ARA6, AtRABF1, Ara-6, AtRab5C Ras-related small GTP-binding family protein (.1.2) AT2G22290 162 / 3e-50 ATRAB6, ATRAB-H1D, AtRABH1d ARABIDOPSIS RAB GTPASE HOMOLOG 6, ARABIDOPSIS RAB GTPASE HOMOLOG H1D, RAB GTPase homolog H1D (.1) AT5G45750 162 / 3e-50 AtRABA1c RAB GTPase homolog A1C (.1) AT5G10260 161 / 4e-50 AtRABH1e RAB GTPase homolog H1E (.1) AT1G06400 161 / 6e-50 ARA2, AtRABA1a, AtRab11E, Ara-2 ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A1A, Ras-related small GTP-binding family protein (.1) AT1G16920 160 / 7e-50 ATRABA4B, RAB11, ATRABA1B RAB GTPase homolog A1B (.1) AT1G09630 160 / 8e-50 ATRAB-A2A, ATRAB11C, ATRABA2A ARABIDOPSIS RAB GTPASE A2A, RAB GTPase 11C (.1) AT4G18800 160 / 8e-50 AthSGBP, AtRab11B, AtRABA1d RAB GTPase homolog A1D (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G113000 [exp] 395 / 1e-142 AT5G45130 339 / 2e-120 ARABIDOPSIS RAB HOMOLOG F2A, RAB homolog 1 (.1) Potri.018G079300 [exp] 294 / 1e-102 AT5G45130 273 / 2e-94 ARABIDOPSIS RAB HOMOLOG F2A, RAB homolog 1 (.1) Potri.003G054900 [exp] 271 / 2e-93 AT4G19640 270 / 4e-93 ARABIDOPSIS RAB GTPASE HOMOLOG F2B, Ras-related small GTP-binding family protein (.1) Potri.010G226300 [exp] 224 / 7e-75 AT3G54840 373 / 7e-134 Ras-related small GTP-binding family protein (.1.2) Potri.008G035800 [exp] 223 / 2e-74 AT3G54840 367 / 3e-131 Ras-related small GTP-binding family protein (.1.2) Potri.010G197200 [exp] 169 / 6e-53 AT1G07410 370 / 3e-132 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1) Potri.019G092500 [exp] 166 / 4e-52 AT5G60860 419 / 2e-151 RAB GTPase homolog A1F (.1) Potri.003G004100 [exp] 166 / 1e-51 AT1G09630 382 / 6e-137 ARABIDOPSIS RAB GTPASE A2A, RAB GTPase 11C (.1) Potri.005G075300 [exp] 161 / 3e-50 AT5G10260 400 / 2e-144 RAB GTPase homolog H1E (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10038334 [exp] 343 / 5e-122 AT5G45130 349 / 3e-124 ARABIDOPSIS RAB HOMOLOG F2A, RAB homolog 1 (.1) Lus10040625 [exp] 339 / 2e-120 AT5G45130 355 / 6e-127 ARABIDOPSIS RAB HOMOLOG F2A, RAB homolog 1 (.1) Lus10018285 [exp] 336 / 4e-119 AT5G45130 359 / 3e-128 ARABIDOPSIS RAB HOMOLOG F2A, RAB homolog 1 (.1) Lus10034903 [exp] 251 / 2e-85 AT5G45130 258 / 2e-88 ARABIDOPSIS RAB HOMOLOG F2A, RAB homolog 1 (.1) Lus10028820 [exp] 219 / 8e-73 AT3G54840 354 / 3e-126 Ras-related small GTP-binding family protein (.1.2) Lus10036196 [exp] 213 / 2e-71 AT5G45130 214 / 2e-72 ARABIDOPSIS RAB HOMOLOG F2A, RAB homolog 1 (.1) Lus10036198 [exp] 210 / 5e-70 AT4G19640 216 / 8e-73 ARABIDOPSIS RAB GTPASE HOMOLOG F2B, Ras-related small GTP-binding family protein (.1) Lus10017462 [exp] 216 / 1e-69 AT3G54840 349 / 1e-121 Ras-related small GTP-binding family protein (.1.2) Lus10025432 [exp] 162 / 4e-50 AT5G60860 422 / 1e-152 RAB GTPase homolog A1F (.1) Lus10041702 [exp] 160 / 7e-50 AT5G10260 404 / 7e-146 RAB GTPase homolog H1E (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0023 [poplar] [flax] P-loop_NTPase PF00025 [poplar] [flax] Arf ADP-ribosylation factor family
Representative CDS sequence Show only first row Show all	>Potri.012G117800.3 pacid=42784367 polypeptide=Potri.012G117800.3.p locus=Potri.012G117800 ID=Potri.012G117800.3.v4.1 annot-version=v4.1 ATGGCCACCACTGGAAACAAGAATATCAATGCTAAATTGGTGCTTCTCGGGGATGTTGGTGCTGGTAAGTCCAGTCTCGTATTGCGTTTTGTCAAAGGAC AGTTTGTTGAGTTTCAGGAATCAACCATAGGTGCTGCCTTTTTCTCGCAAACATTGGCTGTCAATGATGCAACTGTAAAATTTGAGATTTGGGACACAGC AGGCCAGGAGAGATACCACAGCCTGGCTCCAATGTACTACAGGGGAGCTGCTGCAGCAATCATTGTGTATGATATATCTAATCAGGCCTCATTTGAGCGG GCGAAAAAATGGGTTCAAGAACTTCAGGCACAAGGCAACCCAAATATGGTTATGGCACTTGCAGGGAACAAAGCTGATTTGCTGGATGCAAGGAAGGTTA CTGCTGAGGAAGCACAAGTTTATGCCCAGGAGTATGGCCTTTTCTTTATTGAAACATCAGCAAAAACTGCAACCAATGTCAATGACATTTTCTATGAAAT AGCAAAAAGACTACCTCGAGTACAGCCAGCACCAAACCCTTCTGGTATGGTTCTTATGGATAGACCTACTGAAAGTACAGCAAGTGCATCTTGCTGCTCT TAA
AA sequence Show only first row Show all	>Potri.012G117800.3 pacid=42784367 polypeptide=Potri.012G117800.3.p locus=Potri.012G117800 ID=Potri.012G117800.3.v4.1 annot-version=v4.1 MATTGNKNINAKLVLLGDVGAGKSSLVLRFVKGQFVEFQESTIGAAFFSQTLAVNDATVKFEIWDTAGQERYHSLAPMYYRGAAAAIIVYDISNQASFER AKKWVQELQAQGNPNMVMALAGNKADLLDARKVTAEEAQVYAQEYGLFFIETSAKTATNVNDIFYEIAKRLPRVQPAPNPSGMVLMDRPTESTASASCCS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G45130		ATRAB-F2A, RHA1...	ARABIDOPSIS RAB HOMOLOG F2A, R...		Potri.012G117800 [exp]	0	1	ARA7.1
AT1G27000			Protein of unknown function (D...		Potri.010G092700 [exp]	2.00	0.7474
AT3G02520		GENERALREGULATO...	general regulatory factor 7 (....		Potri.004G101700 [exp]	2.44	0.7318
AT4G09830			Uncharacterised conserved prot...		Potri.002G064800 [exp]	4.24	0.7100
AT5G02420			unknown protein		Potri.010G231600 [exp]	8.36	0.6825
AT5G16880			Target of Myb protein 1 (.1.2....		Potri.019G050000 [exp]	9.48	0.6543
AT5G41700		ATUBC8, UBC8	ARABIDOPSIS THALIANA UBIQUITIN...		Potri.019G131400 [exp]	10.19	0.6449	UBC.10
AT1G16180			Serinc-domain containing serin...		Potri.003G186500 [exp]	13.85	0.6456
					Potri.009G086900 [exp]	21.90	0.6491
AT1G76390		PUB43	plant U-box 43, ARM repeat sup...		Potri.002G007800 [exp]	22.00	0.6275
AT3G10640		VPS60.1	SNF7 family protein (.1.2)		Potri.008G018300 [exp]	22.75	0.6447

Compare expression of checked genes

Potri.012G117800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.