Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G19830 270 / 4e-92 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) AT5G13410 75 / 4e-16 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) AT4G26555 70 / 2e-14 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) AT3G10060 64 / 4e-12 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) AT5G48570 63 / 2e-11 ROF2, ATFKBP65 FKBP-type peptidyl-prolyl cis-trans isomerase family protein (.1) AT3G60370 62 / 2e-11 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) AT2G43560 60 / 1e-10 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) AT5G05420 58 / 1e-10 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) AT1G18170 58 / 6e-10 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) AT3G25230 57 / 3e-09 ROF1, ATFKBP62 FK506 BINDING PROTEIN 62, rotamase FKBP 1 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G467100 [exp] 76 / 8e-17 AT4G26555 268 / 3e-92 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) Potri.001G068300 [exp] 69 / 9e-14 AT5G13410 332 / 4e-116 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) Potri.012G129200 [exp] 64 / 7e-12 AT4G25340 344 / 1e-113 FK506 BINDING PROTEIN 53 (.1.2) Potri.016G096600 [exp] 63 / 9e-12 AT3G10060 272 / 6e-93 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) Potri.002G248300 [exp] 62 / 5e-11 AT3G25230 857 / 0.0 FK506 BINDING PROTEIN 62, rotamase FKBP 1 (.1.2) Potri.002G248200 [exp] 59 / 8e-11 AT5G48580 228 / 1e-77 FK506- and rapamycin-binding protein 15 kD-2 (.1) Potri.015G130900 [exp] 61 / 1e-10 AT4G25340 204 / 1e-59 FK506 BINDING PROTEIN 53 (.1.2) Potri.014G045600 [exp] 59 / 2e-10 AT3G60370 302 / 3e-104 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) Potri.002G117200 [exp] 57 / 3e-09 AT5G48570 553 / 0.0 FKBP-type peptidyl-prolyl cis-trans isomerase family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10038345 [exp] 276 / 1e-94 AT4G19830 262 / 3e-89 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) Lus10036206 [exp] 270 / 4e-93 AT4G19830 260 / 4e-89 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) Lus10040937 [exp] 72 / 6e-15 AT5G13410 317 / 1e-109 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) Lus10031700 [exp] 74 / 7e-15 AT4G25340 324 / 3e-105 FK506 BINDING PROTEIN 53 (.1.2) Lus10009828 [exp] 72 / 9e-15 AT5G13410 314 / 1e-108 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) Lus10027129 [exp] 65 / 2e-12 AT4G26555 246 / 5e-83 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) Lus10031121 [exp] 65 / 5e-12 AT4G25340 335 / 3e-110 FK506 BINDING PROTEIN 53 (.1.2) Lus10032895 [exp] 65 / 6e-12 AT4G26550 338 / 8e-116 Got1/Sft2-like vescicle transport protein family (.1) Lus10035560 [exp] 63 / 9e-12 AT3G10060 296 / 2e-102 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) Lus10015029 [exp] 63 / 2e-11 AT4G25340 331 / 8e-110 FK506 BINDING PROTEIN 53 (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0487 [poplar] [flax] FKBP PF00254 [poplar] [flax] FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Representative CDS sequence Show only first row Show all	>Potri.012G119800.3 pacid=42782517 polypeptide=Potri.012G119800.3.p locus=Potri.012G119800 ID=Potri.012G119800.3.v4.1 annot-version=v4.1 ATGTACTATCCGACCATGCCTCCCCAAAAAATGGATAAGGTTTTGGTATTGCTGAACTGCTTCCCATCCCTTCACGTACCCCACCACCTCCCCTCATCAC CTCCGATCTCTTCAACTTCTCCATCACCTCCTTCGCCAACAAGAAGGGCTCTCTCATTGTCTATCATTTCCTTATCCACAGCACTGTTTTCTATACCTAC CTTCTCATGTCCTGCTGCTTCTTCTGCTACTTCAATTACTGACTTCTTGGACCTCCCAAATTCTGGTGGTGTCAAGGCCTTGGACCTTCGCATTGGTTCC GGTCCAGTCCCCGATGAGGGAGACCAGGTTGCAATACATTACTATGGAAGGTTGGCAGCAAAACAAGGGTGGAGGTTTGATTCAACGTATGATCACAAAG ACAGTGCTGGTGAACCTGTTCCTTTTGTTTTCACACTTGGTTCTGGGAAGGTCATTGCTGGCATTGAAACGGCCGTGAGATCAATGAAAGTTGGTGGGGT TCGTAGAGTCATCATTCCACCTTCACAGGGTTACCAGAATACCACTCAAGAACCTTTACCTCCCAATTTCTTCGACAGGCAGAGGCTGTTTACTACCATT TTCAATCCAACACGTCTTGCCAATGGAGAAGGCTCAACATTGGGAACTCTTATATTCGACATTGAGCTTGTCAGCCTGAGGAATCAGTGA
AA sequence Show only first row Show all	>Potri.012G119800.3 pacid=42782517 polypeptide=Potri.012G119800.3.p locus=Potri.012G119800 ID=Potri.012G119800.3.v4.1 annot-version=v4.1 MYYPTMPPQKMDKVLVLLNCFPSLHVPHHLPSSPPISSTSPSPPSPTRRALSLSIISLSTALFSIPTFSCPAASSATSITDFLDLPNSGGVKALDLRIGS GPVPDEGDQVAIHYYGRLAAKQGWRFDSTYDHKDSAGEPVPFVFTLGSGKVIAGIETAVRSMKVGGVRRVIIPPSQGYQNTTQEPLPPNFFDRQRLFTTI FNPTRLANGEGSTLGTLIFDIELVSLRNQ

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G19830			FKBP-like peptidyl-prolyl cis-...		Potri.012G119800 [exp]	0	1
AT1G22700			Tetratricopeptide repeat (TPR)...		Potri.019G085200 [exp]	3.00	0.9229
AT2G32230		PRORP1	proteinaceous RNase P 1 (.1)		Potri.006G160300 [exp]	4.89	0.9311
AT3G09150		ATHY2, GUN3, HY...	GENOMES UNCOUPLED 3, ARABIDOPS...		Potri.001G253700 [exp]	6.92	0.9056
AT1G04880	ARID		HMG (high mobility group) box ...		Potri.017G055200 [exp]	8.94	0.9125
AT2G44920			Tetratricopeptide repeat (TPR)...		Potri.010G200000 [exp]	9.16	0.9175
AT1G79040		PSBR	photosystem II subunit R (.1)		Potri.001G438800 [exp]	9.79	0.8688	Pt-PP1.2
AT4G26555			FKBP-like peptidyl-prolyl cis-...		Potri.001G467100 [exp]	9.94	0.9108
AT1G02910		LPA1	LOW PSII ACCUMULATION1, tetrat...		Potri.002G206300 [exp]	10.00	0.9096
AT1G58200		MSL3	MSCS-like 3 (.1.2)		Potri.005G154000 [exp]	11.00	0.8390
AT1G30520		AAE14	acyl-activating enzyme 14 (.1)		Potri.011G164100 [exp]	11.40	0.8623

Compare expression of checked genes

Potri.012G119800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.