Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G10155 133 / 1e-39 ATPP2-A10 phloem protein 2-A10 (.1) AT1G31200 129 / 2e-38 ATPP2-A9 phloem protein 2-A9 (.1) AT5G24560 52 / 2e-08 ATPP2-B12 phloem protein 2-B12 (.1) AT4G19840 50 / 2e-07 AtPP2A-1, ATPP2-A1 phloem protein 2-A1 (.1) AT2G26820 44 / 2e-05 ATPP2-A3 phloem protein 2-A3 (.1) AT2G02360 43 / 3e-05 ATPP2-B10 phloem protein 2-B10 (.1) AT1G80110 42 / 7e-05 ATPP2-B11 phloem protein 2-B11 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G120200 [exp] 211 / 9e-71 AT1G10155 137 / 4e-41 phloem protein 2-A10 (.1) Potri.012G120280 [exp] 154 / 5e-48 AT1G10155 125 / 1e-36 phloem protein 2-A10 (.1) Potri.012G120160 [exp] 147 / 3e-45 AT1G10155 120 / 1e-34 phloem protein 2-A10 (.1) Potri.015G120100 [exp] 144 / 3e-44 AT1G10155 122 / 2e-35 phloem protein 2-A10 (.1) Potri.015G118900 [exp] 102 / 5e-27 AT1G10155 103 / 5e-27 phloem protein 2-A10 (.1) Potri.015G118800 [exp] 96 / 4e-24 AT1G10155 86 / 4e-20 phloem protein 2-A10 (.1) Potri.015G120000 [exp] 91 / 1e-22 AT1G10155 82 / 6e-19 phloem protein 2-A10 (.1) Potri.015G118850 [exp] 67 / 9e-15 AT1G31200 69 / 3e-15 phloem protein 2-A9 (.1) Potri.015G119100 [exp] 64 / 1e-13 AT1G31200 66 / 4e-14 phloem protein 2-A9 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10040607 [exp] 155 / 3e-46 AT2G39440 164 / 8e-50 unknown protein Lus10018300 [exp] 154 / 3e-46 AT2G39440 164 / 7e-50 unknown protein Lus10040603 [exp] 58 / 1e-10 AT1G33920 82 / 2e-19 phloem protein 2-A4 (.1) Lus10042713 [exp] 58 / 3e-10 AT2G02230 235 / 1e-75 phloem protein 2-B1 (.1) Lus10029674 [exp] 58 / 4e-10 AT2G02230 237 / 2e-76 phloem protein 2-B1 (.1) Lus10018303 [exp] 56 / 9e-10 AT1G65390 84 / 3e-20 phloem protein 2 A5 (.1.2) Lus10040606 [exp] 56 / 1e-09 AT1G65390 87 / 1e-21 phloem protein 2 A5 (.1.2) Lus10018304 [exp] 54 / 1e-08 AT4G19840 197 / 3e-61 phloem protein 2-A1 (.1) Lus10018301 [exp] 52 / 3e-08 AT1G65390 87 / 4e-20 phloem protein 2 A5 (.1.2) Lus10040602 [exp] 47 / 2e-06 AT4G19840 191 / 8e-59 phloem protein 2-A1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF14299 [poplar] [flax] PP2 Phloem protein 2
Representative CDS sequence Show only first row Show all	>Potri.012G120340.1 pacid=42784375 polypeptide=Potri.012G120340.1.p locus=Potri.012G120340 ID=Potri.012G120340.1.v4.1 annot-version=v4.1 ATGTCTTCAAATAAACCACATTACGAGGCAGATCCTGATGACATATTGAGAAGAGATAGCCAAAGGTGGACATTTAAACCGAGGGGCTTCAACATCATAT GGGGCCTTGACGAACGCTACTGGAAATTGCCTGAGAAAGGCAAGGTGGAGCCAGCAGAGCTACTTCAAGTGTGTTGGCTTGAACTAACAGGTACAACGAA GGACTCTCTACCAGAAGGGAAGTACGAAATTAAATTCAAATTAGAGGTGAAACCAGGTGCATTTGGTTTGAGTAATAGTCCTATTTTCATGATGGCTAAG GTAGGGAAGAGGGGAAGATACAAATGGAACAAAATCAAACTACAAGAGAAAAACTCAGACAACAGACCTGTTATCGTAGAACCCACGTTTCAGATTGAGG TTAAAGGAACTACAGATGATAACAAGCTCTATTTTGGTTTGTATGAAGTGTGGACTGGGAAATGGAAGGGAGGTTTGCTAATTCACGGGGCCACAGTTGA TCCAGTCATGAGACCTTGA
AA sequence Show only first row Show all	>Potri.012G120340.1 pacid=42784375 polypeptide=Potri.012G120340.1.p locus=Potri.012G120340 ID=Potri.012G120340.1.v4.1 annot-version=v4.1 MSSNKPHYEADPDDILRRDSQRWTFKPRGFNIIWGLDERYWKLPEKGKVEPAELLQVCWLELTGTTKDSLPEGKYEIKFKLEVKPGAFGLSNSPIFMMAK VGKRGRYKWNKIKLQEKNSDNRPVIVEPTFQIEVKGTTDDNKLYFGLYEVWTGKWKGGLLIHGATVDPVMRP

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G10155		ATPP2-A10	phloem protein 2-A10 (.1)		Potri.012G120340 [exp]	0	1
AT1G10155		ATPP2-A10	phloem protein 2-A10 (.1)		Potri.015G120200 [exp]	2.44	0.8877
AT1G72690			unknown protein		Potri.017G119600 [exp]	3.46	0.8711
AT3G12490		ATCYS6, ATCYSB	ARABIDOPSIS THALIANA PHYTOCYST...		Potri.009G022300 [exp]	7.07	0.8633
AT1G73040			Mannose-binding lectin superfa...		Potri.012G140001 [exp]	7.48	0.8614
AT1G76040		CPK29	calcium-dependent protein kina...		Potri.005G245000 [exp]	10.48	0.8550
AT1G77920	bZIP		bZIP transcription factor fami...		Potri.002G090700 [exp]	13.41	0.8593	TGA3.1
AT1G08970	CCAAT	NF-YC9, HAP5C	"nuclear factor Y, subunit C9"...		Potri.013G025000 [exp]	13.85	0.8640	Pt-HAP5.3
AT2G15680		AtCML30	calmodulin-like 30, Calcium-bi...		Potri.007G042900 [exp]	15.71	0.8309
AT4G19640		ATRAB-F2B, ARA7...	ARABIDOPSIS RAB GTPASE HOMOLOG...		Potri.003G054900 [exp]	15.74	0.8608
					Potri.001G077280 [exp]	16.61	0.8625

Compare expression of checked genes

Potri.012G120340 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.