Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G37760 169 / 7e-52 SQE3 squalene epoxidase 3 (.1) AT2G22830 163 / 5e-49 SQE2 squalene epoxidase 2 (.1) AT1G58440 158 / 2e-47 SQE1, XF1 SQUALENE EPOXIDASE 1, FAD/NAD(P)-binding oxidoreductase family protein (.1) AT5G24150 121 / 7e-34 SQP1, SQE5 SQUALENE MONOOXYGENASE 5, FAD/NAD(P)-binding oxidoreductase family protein (.1), FAD/NAD(P)-binding oxidoreductase family protein (.2) AT5G24160 117 / 3e-32 SQE6 squalene monoxygenase 6 (.1) AT5G24140 102 / 6e-27 SQP2 squalene monooxygenase 2 (.1) AT5G24155 54 / 2e-10 FAD/NAD(P)-binding oxidoreductase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G120900 [exp] 181 / 5e-56 AT1G58440 745 / 0.0 SQUALENE EPOXIDASE 1, FAD/NAD(P)-binding oxidoreductase family protein (.1) Potri.007G007600 [exp] 170 / 2e-51 AT4G37760 795 / 0.0 squalene epoxidase 3 (.1) Potri.005G146700 [exp] 168 / 2e-51 AT1G58440 766 / 0.0 SQUALENE EPOXIDASE 1, FAD/NAD(P)-binding oxidoreductase family protein (.1) Potri.002G114500 [exp] 164 / 7e-50 AT1G58440 761 / 0.0 SQUALENE EPOXIDASE 1, FAD/NAD(P)-binding oxidoreductase family protein (.1) Potri.012G121136 [exp] 155 / 7e-47 AT1G58440 564 / 0.0 SQUALENE EPOXIDASE 1, FAD/NAD(P)-binding oxidoreductase family protein (.1) Potri.019G014376 [exp] 120 / 1e-33 AT1G58440 575 / 0.0 SQUALENE EPOXIDASE 1, FAD/NAD(P)-binding oxidoreductase family protein (.1) Potri.019G014378 [exp] 115 / 1e-31 AT1G58440 603 / 0.0 SQUALENE EPOXIDASE 1, FAD/NAD(P)-binding oxidoreductase family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10018654 [exp] 170 / 6e-52 AT1G58440 827 / 0.0 SQUALENE EPOXIDASE 1, FAD/NAD(P)-binding oxidoreductase family protein (.1) Lus10039649 [exp] 167 / 3e-50 AT1G58440 791 / 0.0 SQUALENE EPOXIDASE 1, FAD/NAD(P)-binding oxidoreductase family protein (.1) Lus10007718 [exp] 166 / 3e-50 AT1G58440 828 / 0.0 SQUALENE EPOXIDASE 1, FAD/NAD(P)-binding oxidoreductase family protein (.1) Lus10011732 [exp] 162 / 8e-49 AT1G58440 785 / 0.0 SQUALENE EPOXIDASE 1, FAD/NAD(P)-binding oxidoreductase family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.012G120676.1 pacid=42783301 polypeptide=Potri.012G120676.1.p locus=Potri.012G120676 ID=Potri.012G120676.1.v4.1 annot-version=v4.1 ATGTTTCTGTACATATTGCAGGATGGTCGAAGAGTGCATGTAATTGAAAAAGACTTGACTGAGCCTGACAGAATTGTTGGAGAACTCCTGCAACCCGGAG GTTACCTGAAATTAATTGAATTGGGCCTTGAAGACTGTGTGAGTGAAATTGATGCTCAAAGAGTGCTTGGATATGCAATCTTTAAAGATGGGAAAAGTAC CAAACTATCATACCCCTTGGAGAACTTCCTTTCAGATGTTGCTGGAAGAAGCTTTCACAATGGCCGTTTTATTCAGAAAATGCGAGACAAAGCATAA
AA sequence Show only first row Show all	>Potri.012G120676.1 pacid=42783301 polypeptide=Potri.012G120676.1.p locus=Potri.012G120676 ID=Potri.012G120676.1.v4.1 annot-version=v4.1 MFLYILQDGRRVHVIEKDLTEPDRIVGELLQPGGYLKLIELGLEDCVSEIDAQRVLGYAIFKDGKSTKLSYPLENFLSDVAGRSFHNGRFIQKMRDKA

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G37760		SQE3	squalene epoxidase 3 (.1)		Potri.012G120676 [exp]	0	1
AT2G39510			nodulin MtN21 /EamA-like trans...		Potri.008G051500 [exp]	1.41	0.9840
AT1G43800			Plant stearoyl-acyl-carrier-pr...		Potri.005G187600 [exp]	2.82	0.9708
AT3G29970			B12D protein (.1)		Potri.017G098800 [exp]	4.24	0.9608
AT4G38260			Protein of unknown function (D...		Potri.005G252250 [exp]	5.47	0.9279
AT4G34950			Major facilitator superfamily ...		Potri.005G112400 [exp]	7.41	0.9307
AT4G23260		CRK18	cysteine-rich RLK (RECEPTOR-li...		Potri.005G014950 [exp]	10.67	0.8897
AT1G65820			microsomal glutathione s-trans...		Potri.017G140900 [exp]	11.66	0.9257
AT1G52190			Major facilitator superfamily ...		Potri.018G041600 [exp]	12.36	0.9193
AT1G52190			Major facilitator superfamily ...		Potri.018G041500 [exp]	12.40	0.9140
AT3G50470		MLA10, HR3	INTRACELLULAR MILDEW A 10, hom...		Potri.007G038600 [exp]	13.85	0.8515

Compare expression of checked genes

Potri.012G120676 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.