Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G14470 93 / 2e-21 NB-ARC domain-containing disease resistance protein (.1) AT3G14460 89 / 4e-20 LRR and NB-ARC domains-containing disease resistance protein (.1) AT1G69550 74 / 6e-15 disease resistance protein (TIR-NBS-LRR class) (.1) AT3G04220 66 / 3e-12 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT5G17680 60 / 3e-10 disease resistance protein (TIR-NBS-LRR class), putative (.1) AT5G04720 59 / 4e-10 PHX21, ADR1-L2 PHOENIX 21, ADR1-like 2 (.1) AT5G44510 59 / 5e-10 TAO1 target of AVRB operation1 (.1) AT1G27170 58 / 1e-09 transmembrane receptors;ATP binding (.1.2) AT3G25510 58 / 1e-09 disease resistance protein (TIR-NBS-LRR class), putative (.1) AT5G18350 58 / 1e-09 Disease resistance protein (TIR-NBS-LRR class) family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G121851 [exp] 390 / 8e-132 AT3G14470 348 / 2e-105 NB-ARC domain-containing disease resistance protein (.1) Potri.012G122900 [exp] 365 / 3e-121 AT3G14470 414 / 6e-129 NB-ARC domain-containing disease resistance protein (.1) Potri.012G121900 [exp] 360 / 1e-118 AT3G14470 399 / 2e-122 NB-ARC domain-containing disease resistance protein (.1) Potri.012G123200 [exp] 359 / 3e-118 AT3G14470 407 / 1e-125 NB-ARC domain-containing disease resistance protein (.1) Potri.012G121801 [exp] 356 / 2e-117 AT3G14470 410 / 3e-127 NB-ARC domain-containing disease resistance protein (.1) Potri.012G123400 [exp] 352 / 1e-116 AT3G14470 376 / 2e-115 NB-ARC domain-containing disease resistance protein (.1) Potri.012G123500 [exp] 350 / 5e-115 AT3G14470 395 / 4e-121 NB-ARC domain-containing disease resistance protein (.1) Potri.012G121876 [exp] 343 / 2e-112 AT3G14470 404 / 6e-125 NB-ARC domain-containing disease resistance protein (.1) Potri.012G122200 [exp] 341 / 1e-111 AT3G14470 411 / 2e-127 NB-ARC domain-containing disease resistance protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10022900 [exp] 99 / 2e-23 AT3G14470 350 / 2e-104 NB-ARC domain-containing disease resistance protein (.1) Lus10029705 [exp] 97 / 2e-23 AT3G14460 112 / 5e-27 LRR and NB-ARC domains-containing disease resistance protein (.1) Lus10039540 [exp] 94 / 6e-22 AT3G14470 727 / 0.0 NB-ARC domain-containing disease resistance protein (.1) Lus10004126 [exp] 94 / 1e-21 AT3G14470 353 / 6e-106 NB-ARC domain-containing disease resistance protein (.1) Lus10004127 [exp] 94 / 1e-21 AT3G14470 350 / 5e-105 NB-ARC domain-containing disease resistance protein (.1) Lus10011278 [exp] 86 / 7e-19 AT3G14470 356 / 1e-105 NB-ARC domain-containing disease resistance protein (.1) Lus10007261 [exp] 85 / 1e-18 AT3G14460 654 / 0.0 LRR and NB-ARC domains-containing disease resistance protein (.1) Lus10039509 [exp] 81 / 2e-17 AT3G14460 613 / 0.0 LRR and NB-ARC domains-containing disease resistance protein (.1) Lus10002609 [exp] 79 / 1e-16 AT3G14470 364 / 9e-110 NB-ARC domain-containing disease resistance protein (.1) Lus10008584 [exp] 78 / 2e-16 AT3G14470 186 / 2e-49 NB-ARC domain-containing disease resistance protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0022 [poplar] [flax] LRR PF00560 [poplar] [flax] LRR_1 Leucine Rich Repeat
Representative CDS sequence Show only first row Show all	>Potri.012G121725.1 pacid=42784194 polypeptide=Potri.012G121725.1.p locus=Potri.012G121725 ID=Potri.012G121725.1.v4.1 annot-version=v4.1 ATGGAGACTTCAATTGAAAGGGTTCGTCATTTAAGCATGATGCTGTCAAACGAGACCTCTTTTCCCGTGTCCATTCACAAAGCAAAAGGTCTTCGCAGCC TCTTGATCAACACTAGAGACCCTTCGCTTGGAGCTGCACTGCCTGATTTGTTCAAGCAGTTGACATGCATCAGGTTATTGAATTTGTCAAGGTCTTCAAT CAAAGAAATACCAAACGAGGTAGGGAAATTGATACATTTGAGACACCTTAATTTGGCATCTTGTTATCAGTTGGAGTCCCTGCCAGAAACCATGTGTGAT TTATGCAATCTGCAATCCCTAGACGTTACTTGGTGTGATTCTCTCAAGGAATTGCCTAATGCGATTGGAAAACTTATCAAATTGAGGCATCTCTGGATTT ATGGTTCAGGAGTGGCCTTCATACCAAAGGGAATAGAGAGGATAACATGTCTTCGAACATTAGATGTGTTTACTATGTGTGGTGGTGGTGAGAATGAAAG TAAAGCAGCTAATCTAAGAGAATTAAAAAACTTAAATCACATTGGAGGGAGTCTTAAGATATGGAATCTACGAGGAGGTGTAGAAGATGCGAGTGACGCT GCAGAAGCACAGCTCAAGAATAAGAAACGCCTGCGTTGTTTGCTATTGGCTTTAATTCGACTACAGCCGGCAGAACGGCATTTTAATTGA
AA sequence Show only first row Show all	>Potri.012G121725.1 pacid=42784194 polypeptide=Potri.012G121725.1.p locus=Potri.012G121725 ID=Potri.012G121725.1.v4.1 annot-version=v4.1 METSIERVRHLSMMLSNETSFPVSIHKAKGLRSLLINTRDPSLGAALPDLFKQLTCIRLLNLSRSSIKEIPNEVGKLIHLRHLNLASCYQLESLPETMCD LCNLQSLDVTWCDSLKELPNAIGKLIKLRHLWIYGSGVAFIPKGIERITCLRTLDVFTMCGGGENESKAANLRELKNLNHIGGSLKIWNLRGGVEDASDA AEAQLKNKKRLRCLLLALIRLQPAERHFN

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G14470			NB-ARC domain-containing disea...		Potri.012G121725 [exp]	0	1
AT3G12210			DNA binding (.1.2)		Potri.002G114400 [exp]	1.00	0.9345
AT3G14470			NB-ARC domain-containing disea...		Potri.017G014900 [exp]	4.00	0.9306
AT1G32790		CID11	CTC-interacting domain 11 (.1....		Potri.001G448800 [exp]	6.92	0.9184
AT1G66680		AR401	S-adenosyl-L-methionine-depend...		Potri.012G068600 [exp]	8.00	0.9139
AT3G14470			NB-ARC domain-containing disea...		Potri.003G025904 [exp]	9.05	0.8811
AT4G02550			unknown protein		Potri.003G047151 [exp]	10.48	0.9002
AT5G12920			Transducin/WD40 repeat-like su...		Potri.001G016800 [exp]	10.95	0.8906
AT4G27190			NB-ARC domain-containing disea...		Potri.018G136700 [exp]	12.36	0.9034
AT4G02550			unknown protein		Potri.011G163248 [exp]	12.68	0.9099
AT5G40270			HD domain-containing metal-dep...		Potri.009G147800 [exp]	13.03	0.9121

Compare expression of checked genes

Potri.012G121725 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.