Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G58807 52 / 5e-08 Disease resistance protein (CC-NBS-LRR class) family (.1), Disease resistance protein (CC-NBS-LRR class) family (.2) AT1G58400 50 / 1e-07 Disease resistance protein (CC-NBS-LRR class) family (.1) AT1G59780 49 / 5e-07 NB-ARC domain-containing disease resistance protein (.1) AT1G58390 45 / 9e-06 Disease resistance protein (CC-NBS-LRR class) family (.1) AT1G58602 43 / 4e-05 LRR and NB-ARC domains-containing disease resistance protein (.1.2) AT5G35450 43 / 6e-05 Disease resistance protein (CC-NBS-LRR class) family (.1) AT5G43470 42 / 0.0001 HRT, RCY1, RPP8 RECOGNITION OF PERONOSPORA PARASITICA 8, RESISTANT TO CMV\(Y\) 1, HYPERSENSITIVE RESPONSE TO TCV, Disease resistance protein (CC-NBS-LRR class) family (.1), Disease resistance protein (CC-NBS-LRR class) family (.2) AT5G48620 42 / 0.0001 Disease resistance protein (CC-NBS-LRR class) family (.1) AT1G59218 41 / 0.0002 Disease resistance protein (CC-NBS-LRR class) family (.1), Disease resistance protein (CC-NBS-LRR class) family (.2) AT1G58848 41 / 0.0002 Disease resistance protein (CC-NBS-LRR class) family (.1), Disease resistance protein (CC-NBS-LRR class) family (.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G121900 [exp] 210 / 2e-63 AT3G14470 399 / 2e-122 NB-ARC domain-containing disease resistance protein (.1) Potri.012G121851 [exp] 207 / 7e-63 AT3G14470 348 / 2e-105 NB-ARC domain-containing disease resistance protein (.1) Potri.012G123200 [exp] 202 / 1e-60 AT3G14470 407 / 1e-125 NB-ARC domain-containing disease resistance protein (.1) Potri.012G122200 [exp] 196 / 9e-59 AT3G14470 411 / 2e-127 NB-ARC domain-containing disease resistance protein (.1) Potri.012G123400 [exp] 193 / 1e-57 AT3G14470 376 / 2e-115 NB-ARC domain-containing disease resistance protein (.1) Potri.012G121876 [exp] 190 / 2e-56 AT3G14470 404 / 6e-125 NB-ARC domain-containing disease resistance protein (.1) Potri.012G123500 [exp] 186 / 8e-55 AT3G14470 395 / 4e-121 NB-ARC domain-containing disease resistance protein (.1) Potri.012G122900 [exp] 170 / 2e-49 AT3G14470 414 / 6e-129 NB-ARC domain-containing disease resistance protein (.1) Potri.012G121801 [exp] 161 / 4e-46 AT3G14470 410 / 3e-127 NB-ARC domain-containing disease resistance protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10002609 [exp] 69 / 6e-14 AT3G14470 364 / 9e-110 NB-ARC domain-containing disease resistance protein (.1) Lus10020361 [exp] 61 / 3e-11 AT3G03470 67 / 2e-12 "cytochrome P450, family 87, subfamily A, polypeptide 9", cytochrome P450, family 87, subfamily A, polypeptide 9 (.1) Lus10022900 [exp] 60 / 1e-10 AT3G14470 350 / 2e-104 NB-ARC domain-containing disease resistance protein (.1) Lus10003571 [exp] 56 / 2e-09 AT3G14470 363 / 6e-110 NB-ARC domain-containing disease resistance protein (.1) Lus10004126 [exp] 50 / 3e-07 AT3G14470 353 / 6e-106 NB-ARC domain-containing disease resistance protein (.1) Lus10026109 [exp] 49 / 6e-07 AT3G14470 598 / 0.0 NB-ARC domain-containing disease resistance protein (.1) Lus10022792 [exp] 47 / 3e-06 AT3G14470 343 / 7e-102 NB-ARC domain-containing disease resistance protein (.1) Lus10039509 [exp] 46 / 4e-06 AT3G14460 613 / 0.0 LRR and NB-ARC domains-containing disease resistance protein (.1) Lus10004127 [exp] 45 / 1e-05 AT3G14470 350 / 5e-105 NB-ARC domain-containing disease resistance protein (.1) Lus10028075 [exp] 44 / 2e-05 AT3G07040 168 / 1e-43 RESISTANCE TO PSEUDOMONAS SYRINGAE 3, RESISTANCE TO P. SYRINGAE PV MACULICOLA 1, NB-ARC domain-containing disease resistance protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.012G121775.1 pacid=42783823 polypeptide=Potri.012G121775.1.p locus=Potri.012G121775 ID=Potri.012G121775.1.v4.1 annot-version=v4.1 ATGATGATATTAACCAGATTACAGAACCTTGTGCTCGTAAATTGTAGAAACCTCGATGTTTTGCCACCGCTGGGAAGATTGCCCAACCTCGAAAGCCTTT CTTTAACAAGGTTGAAGCTGAGAAGGTTGGATGGTGGATTTTTAGGCATAGAAAATGTTGGCAATACCAATATTAATGAAGGAGAAATTGCAAGAGTCGC TGCTTTCCCCAAATTGAAAAAACTTAGCATATGGCATCTCAAAGAACTAGAGGAGTGGGATGGGATTGAAAGGAGAGTGGTAGAAGAAGATTCCACCACG ACTTCAATATTCATCATGCCACAACTTGTTGAGTTTAGAATTCTCAAATGCCCATTGTTGAGAGCACTACCGGACTATGTTTTGATAGCGCCTCTACAGA AATTCTCCATAGAGTATTGCCCCAATCTAAGGAAACGTTACGATAGGGATAGGGAGGAGATGGGTGAAGATGGGCACAGGATTTCTCACATCCCAAACAT TCTATTTAAAGAATAG
AA sequence Show only first row Show all	>Potri.012G121775.1 pacid=42783823 polypeptide=Potri.012G121775.1.p locus=Potri.012G121775 ID=Potri.012G121775.1.v4.1 annot-version=v4.1 MMILTRLQNLVLVNCRNLDVLPPLGRLPNLESLSLTRLKLRRLDGGFLGIENVGNTNINEGEIARVAAFPKLKKLSIWHLKELEEWDGIERRVVEEDSTT TSIFIMPQLVEFRILKCPLLRALPDYVLIAPLQKFSIEYCPNLRKRYDRDREEMGEDGHRISHIPNILFKE

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G58807			Disease resistance protein (CC...		Potri.012G121775 [exp]	0	1
AT4G30820			cyclin-dependent kinase-activa...		Potri.018G103200 [exp]	20.63	0.5271
AT5G63670		SPT42	SPT4 homolog 2 (.1.2)		Potri.010G255000 [exp]	24.12	0.5078
AT4G17170		ATRAB-B1B, AT-R...	ARABIDOPSIS RAB GTPASE HOMOLOG...		Potri.016G002200 [exp]	25.49	0.5132	RAB2.1
AT5G59140			BTB/POZ domain-containing prot...		Potri.009G037800 [exp]	40.73	0.5044
AT5G47540			Mo25 family protein (.1)		Potri.016G011100 [exp]	79.37	0.4659
AT1G50740			Transmembrane proteins 14C (.1...		Potri.011G138100 [exp]	195.03	0.3999
					Potri.001G286150 [exp]	216.16	0.3911

Compare expression of checked genes

Potri.012G121775 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.