Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G16470 115 / 2e-33 PAB1 proteasome subunit PAB1 (.1.2) AT1G79210 115 / 2e-33 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3) AT3G14290 56 / 3e-10 PAE2 20S proteasome alpha subunit E2 (.1) AT1G53850 56 / 3e-10 PAE1, ATPAE1 ARABIDOPSIS 20S PROTEASOME ALPHA SUBUNIT E1, 20S proteasome alpha subunit E1 (.1.2) AT2G05840 52 / 2e-09 PAA2 20S proteasome subunit PAA2 (.1.2) AT5G35590 52 / 5e-09 PAA1 proteasome alpha subunit A1 (.1) AT4G15165 52 / 5e-09 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1) AT3G51260 50 / 2e-08 PAD1 20S proteasome alpha subunit PAD1 (.1.2) AT2G27020 50 / 2e-08 PAG1 20S proteasome alpha subunit G1 (.1) AT5G66140 50 / 2e-08 PAD2 proteasome alpha subunit D2 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G123550 [exp] 118 / 3e-34 AT1G16470 456 / 1e-165 proteasome subunit PAB1 (.1.2) Potri.015G122400 [exp] 118 / 3e-34 AT1G16470 456 / 1e-165 proteasome subunit PAB1 (.1.2) Potri.003G072500 [exp] 55 / 3e-10 AT3G14290 464 / 1e-168 20S proteasome alpha subunit E2 (.1) Potri.001G162900 [exp] 55 / 4e-10 AT3G14290 471 / 4e-171 20S proteasome alpha subunit E2 (.1) Potri.016G139600 [exp] 52 / 6e-09 AT2G05840 459 / 2e-166 20S proteasome subunit PAA2 (.1.2) Potri.006G110800 [exp] 52 / 7e-09 AT2G05840 453 / 7e-164 20S proteasome subunit PAA2 (.1.2) Potri.006G140400 [exp] 51 / 8e-09 AT2G05840 463 / 7e-168 20S proteasome subunit PAA2 (.1.2) Potri.009G020800 [exp] 50 / 1e-08 AT2G27020 453 / 5e-164 20S proteasome alpha subunit G1 (.1) Potri.001G224100 [exp] 50 / 1e-08 AT2G27020 457 / 3e-165 20S proteasome alpha subunit G1 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10017135 [exp] 116 / 1e-33 AT1G16470 454 / 1e-164 proteasome subunit PAB1 (.1.2) Lus10036210 [exp] 116 / 1e-33 AT1G16470 450 / 3e-163 proteasome subunit PAB1 (.1.2) Lus10018318 [exp] 117 / 1e-31 AT2G35130 801 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) Lus10037454 [exp] 55 / 8e-10 AT1G53850 464 / 8e-163 ARABIDOPSIS 20S PROTEASOME ALPHA SUBUNIT E1, 20S proteasome alpha subunit E1 (.1.2) Lus10003936 [exp] 54 / 1e-09 AT1G53850 463 / 9e-162 ARABIDOPSIS 20S PROTEASOME ALPHA SUBUNIT E1, 20S proteasome alpha subunit E1 (.1.2) Lus10004235 [exp] 51 / 8e-09 AT3G22110 375 / 2e-134 20S proteasome alpha subunit C1 (.1) Lus10042145 [exp] 51 / 9e-09 AT3G22110 474 / 3e-172 20S proteasome alpha subunit C1 (.1) Lus10027669 [exp] 51 / 2e-08 AT2G05840 473 / 1e-171 20S proteasome subunit PAA2 (.1.2) Lus10037416 [exp] 50 / 2e-08 AT2G27020 478 / 1e-173 20S proteasome alpha subunit G1 (.1) Lus10041890 [exp] 49 / 9e-08 AT5G66140 442 / 9e-160 proteasome alpha subunit D2 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0052 [poplar] [flax] NTN PF00227 [poplar] [flax] Proteasome Proteasome subunit CL0052 [poplar] [flax] NTN PF10584 [poplar] [flax] Proteasome_A_N Proteasome subunit A N-terminal signature
Representative CDS sequence Show only first row Show all	>Potri.012G123100.1 pacid=42783268 polypeptide=Potri.012G123100.1.p locus=Potri.012G123100 ID=Potri.012G123100.1.v4.1 annot-version=v4.1 ATGGGTGATAGCCAGTACTCCTTTTCTCTCACTACTTTCAGTCCTACCGGAAAGCTAGTACAGATTGAGCACGCATTGACTGCCGTTGGATCAGGCCAAA CTTCTCTCGGAATCAAAGCGGCAAACGGTGTTGTTATTGCAACTGAGAAGAAATTGCCATCTATTTTAATCGATGAATCTTCTGTAAGTAAACTTTTTTT TTTTTTTTCGGTTTTGTTATATTCTTTGGTTGAAATTCAAGAAACCCTTTTGTTTTTTTGCGTTTTTTATTGTGTTTTCTTTGTGAACTTTTCGGGCTGG CCCTGCGATCTTTTAGTAATAACCTAA
AA sequence Show only first row Show all	>Potri.012G123100.1 pacid=42783268 polypeptide=Potri.012G123100.1.p locus=Potri.012G123100 ID=Potri.012G123100.1.v4.1 annot-version=v4.1 MGDSQYSFSLTTFSPTGKLVQIEHALTAVGSGQTSLGIKAANGVVIATEKKLPSILIDESSVSKLFFFFSVLLYSLVEIQETLLFFCVFYCVFFVNFSGW PCDLLVIT

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G79210			N-terminal nucleophile aminohy...		Potri.012G123100 [exp]	0	1
AT1G17960			Threonyl-tRNA synthetase (.1)		Potri.010G096550 [exp]	3.74	0.8774
AT4G21530		APC4	anaphase promoting complex 4, ...		Potri.004G034900 [exp]	4.00	0.8641
AT3G20630		PER1, ATUBP14, ...	TITAN6, phosphate deficiency r...		Potri.001G408800 [exp]	6.48	0.8508	Pt-UBP14.2
AT5G09500			Ribosomal protein S19 family p...		Potri.004G074201 [exp]	6.92	0.8342
					Potri.005G038350 [exp]	11.22	0.8391
AT2G33860	ARF	ARF3, ETT	ETTIN, AUXIN RESPONSE TRANSCRI...		Potri.011G059101 [exp]	11.66	0.8442
AT2G39090		APC7, AtAPC7	anaphase-promoting complex 7, ...		Potri.008G215100 [exp]	20.83	0.8121
AT2G14120		DRP3B	dynamin related protein (.1.2....		Potri.012G125300 [exp]	23.91	0.7592
AT3G58610			ketol-acid reductoisomerase (....		Potri.014G055100 [exp]	29.66	0.8010
AT1G07410		ATRAB-A2B, AtRA...	ARABIDOPSIS RAB GTPASE HOMOLOG...		Potri.008G061300 [exp]	30.29	0.8137	RAB11.9

Compare expression of checked genes

Potri.012G123100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.