Potri.012G123550 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G16470 456 / 1e-165 PAB1 proteasome subunit PAB1 (.1.2)
AT1G79210 453 / 2e-164 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3)
AT5G66140 168 / 1e-51 PAD2 proteasome alpha subunit D2 (.1)
AT3G51260 164 / 5e-50 PAD1 20S proteasome alpha subunit PAD1 (.1.2)
AT1G53850 156 / 3e-47 PAE1, ATPAE1 ARABIDOPSIS 20S PROTEASOME ALPHA SUBUNIT E1, 20S proteasome alpha subunit E1 (.1.2)
AT3G14290 154 / 2e-46 PAE2 20S proteasome alpha subunit E2 (.1)
AT3G22110 154 / 3e-46 PAC1 20S proteasome alpha subunit C1 (.1)
AT5G35590 153 / 5e-46 PAA1 proteasome alpha subunit A1 (.1)
AT2G05840 149 / 2e-44 PAA2 20S proteasome subunit PAA2 (.1.2)
AT5G42790 146 / 5e-43 ARS5, ATPSM30, PAF1 ARSENIC TOLERANCE 5, proteasome alpha subunit F1 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.015G122400 480 / 4e-175 AT1G16470 456 / 1e-165 proteasome subunit PAB1 (.1.2)
Potri.004G174200 175 / 1e-54 AT3G51260 406 / 2e-145 20S proteasome alpha subunit PAD1 (.1.2)
Potri.009G133800 174 / 3e-54 AT5G66140 409 / 2e-146 proteasome alpha subunit D2 (.1)
Potri.006G110800 160 / 1e-48 AT2G05840 453 / 7e-164 20S proteasome subunit PAA2 (.1.2)
Potri.003G072500 159 / 2e-48 AT3G14290 464 / 1e-168 20S proteasome alpha subunit E2 (.1)
Potri.001G162900 158 / 4e-48 AT3G14290 471 / 4e-171 20S proteasome alpha subunit E2 (.1)
Potri.006G140400 156 / 3e-47 AT2G05840 463 / 7e-168 20S proteasome subunit PAA2 (.1.2)
Potri.016G015400 154 / 2e-46 AT3G22110 445 / 1e-160 20S proteasome alpha subunit C1 (.1)
Potri.006G008800 153 / 5e-46 AT3G22110 452 / 1e-163 20S proteasome alpha subunit C1 (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10017135 466 / 1e-169 AT1G16470 454 / 1e-164 proteasome subunit PAB1 (.1.2)
Lus10036210 463 / 3e-168 AT1G16470 450 / 3e-163 proteasome subunit PAB1 (.1.2)
Lus10018318 437 / 5e-150 AT2G35130 801 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
Lus10041890 173 / 2e-53 AT5G66140 442 / 9e-160 proteasome alpha subunit D2 (.1)
Lus10028437 167 / 1e-51 AT5G66140 417 / 8e-150 proteasome alpha subunit D2 (.1)
Lus10027669 158 / 7e-48 AT2G05840 473 / 1e-171 20S proteasome subunit PAA2 (.1.2)
Lus10042145 157 / 3e-47 AT3G22110 474 / 3e-172 20S proteasome alpha subunit C1 (.1)
Lus10004235 150 / 1e-45 AT3G22110 375 / 2e-134 20S proteasome alpha subunit C1 (.1)
Lus10037454 155 / 8e-44 AT1G53850 464 / 8e-163 ARABIDOPSIS 20S PROTEASOME ALPHA SUBUNIT E1, 20S proteasome alpha subunit E1 (.1.2)
Lus10003936 155 / 1e-43 AT1G53850 463 / 9e-162 ARABIDOPSIS 20S PROTEASOME ALPHA SUBUNIT E1, 20S proteasome alpha subunit E1 (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0052 NTN PF00227 Proteasome Proteasome subunit
CL0052 NTN PF10584 Proteasome_A_N Proteasome subunit A N-terminal signature
Representative CDS sequence
>Potri.012G123550.1 pacid=42782822 polypeptide=Potri.012G123550.1.p locus=Potri.012G123550 ID=Potri.012G123550.1.v4.1 annot-version=v4.1
ATGGGTGATAGCCAGTACTCCTTTTCTCTCACTACTTTCAGTCCTACCGGAAAGCTAGTACAGATTGAGCACGCATTGACTGCCGTTGGATCAGGCCAAA
CTTCTCTCGGAATCAAAGCGGCAAACGGTGTTGTTATTGCAACTGAGAAGAAATTGCCATCTATTTTAGTCGATGAATCTTCTGTTCAGAAAATACAGAA
TCTGACACCCAATATTGGTGTTGTCTACAGTGGAATGGGTCCTGACTTTCGAGTTTTGGTTCGGAAAAGTAGGAAGCAAGCAGAACAATATCATAGACTG
TACAAGGAACCAATTCCTGTCACACAACTTGTGAGGGAAACTGCTGCTGTCATGCAAGAGTTTACTCAATCTGGAGGTGTAAGGCCTTTTGGAGTATCTT
TGCTAGTCGCTGGTTTTGATGACAAAGGTCCACAGCTATACCAGGTGGATCCATCAGGTTCCTACTTCTCATGGAAAGCCTCAGCAATGGGGAAAAATGT
TTCAAATGCAAAAACATTTCTTGAGAAGAGATACACTGATGATATGGAGCTTGATGATGCTGTGCACACCGCTATCTTGACACTAAAAGAGGGATTTGAA
GGACAGATTTCTGGGAAAAACATTGAAATTGGGATAATTGGTGCTGACAAGCAATTCAGGGTACTAACTCCAGCCGAAATTGATGATTATTTGGCTGAAG
TGGAATAG
AA sequence
>Potri.012G123550.1 pacid=42782822 polypeptide=Potri.012G123550.1.p locus=Potri.012G123550 ID=Potri.012G123550.1.v4.1 annot-version=v4.1
MGDSQYSFSLTTFSPTGKLVQIEHALTAVGSGQTSLGIKAANGVVIATEKKLPSILVDESSVQKIQNLTPNIGVVYSGMGPDFRVLVRKSRKQAEQYHRL
YKEPIPVTQLVRETAAVMQEFTQSGGVRPFGVSLLVAGFDDKGPQLYQVDPSGSYFSWKASAMGKNVSNAKTFLEKRYTDDMELDDAVHTAILTLKEGFE
GQISGKNIEIGIIGADKQFRVLTPAEIDDYLAEVE

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G16470 PAB1 proteasome subunit PAB1 (.1.2) Potri.012G123550 0 1
AT3G15660 ATGRX4 A. THALIANA GLUTAREDOXIN 4, gl... Potri.003G060600 3.00 0.7510
AT1G10865 unknown protein Potri.008G010300 4.24 0.7046
AT5G44200 ATCBP20, CBP20 CAP-binding protein 20 (.1.2) Potri.007G137400 6.00 0.7218
AT5G61840 GUT1, IRX10-L Exostosin family protein (.1) Potri.015G116700 9.00 0.6718
AT3G07590 Small nuclear ribonucleoprotei... Potri.002G054800 12.00 0.7232
AT4G02840 Small nuclear ribonucleoprotei... Potri.005G207900 12.12 0.7219
AT3G12180 Cornichon family protein (.1) Potri.006G057300 14.42 0.6492
AT1G08360 Ribosomal protein L1p/L10e fam... Potri.004G202766 14.86 0.6594
AT2G35605 SWIB/MDM2 domain superfamily p... Potri.005G078400 19.62 0.6992
AT3G60830 ATARP7 actin-related protein 7 (.1) Potri.009G060200 20.07 0.6215 ARP902,Pt-ARP7.2

Potri.012G123550 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.