gdcH1 (Potri.012G123700) [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol gdcH1
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G35120 217 / 1e-73 Single hybrid motif superfamily protein (.1)
AT1G32470 181 / 2e-59 Single hybrid motif superfamily protein (.1)
AT2G35370 178 / 5e-58 GDCH glycine decarboxylase complex H (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.015G122500 264 / 3e-92 AT2G35120 224 / 2e-76 Single hybrid motif superfamily protein (.1)
Potri.003G089300 177 / 8e-58 AT1G32470 260 / 3e-90 Single hybrid motif superfamily protein (.1)
Potri.001G144800 176 / 2e-57 AT1G32470 255 / 3e-88 Single hybrid motif superfamily protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10018319 238 / 1e-81 AT2G35120 244 / 2e-84 Single hybrid motif superfamily protein (.1)
Lus10030979 172 / 2e-55 AT1G32470 254 / 4e-88 Single hybrid motif superfamily protein (.1)
Lus10035374 171 / 2e-55 AT1G32470 254 / 6e-88 Single hybrid motif superfamily protein (.1)
Lus10017133 155 / 2e-49 AT2G35120 162 / 1e-52 Single hybrid motif superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0105 Hybrid PF01597 GCV_H Glycine cleavage H-protein
Representative CDS sequence
>Potri.012G123700.4 pacid=42782693 polypeptide=Potri.012G123700.4.p locus=Potri.012G123700 ID=Potri.012G123700.4.v4.1 annot-version=v4.1
ATGGCTTCAAGATTGTTGTGGGCTTCAAGGGCTGCTTCTTACCTTAGGATCTCTGTTTCTCATAGAGGGTTTGCTTCTGTTGTAAAGGACTTGAAGTATG
CTGAAAGTCATGAATGGGTAAAGGTTGATGGTAAAACTGCTACTGTTGGTATAACCGATCATGCTCAAGACCATTTAGGTGATGTTGTGTATGTTGAATT
ACCGGAAGTGGGTGTTACTGTGAATCAGGGTTCTGGATTTGGCGCAGTTGAAAGTGTCAAGGCTACCAGTGATGTCTATTCTCCTGTTTCGGGAGATGTG
GTCGAAGTTAATGAAGAACTGAACAGCTCTCCTGGTTTGGTCAATTCAAGCCCCTATGAGAAGGGATGGATTATGAAGGTTGAAATTAAAGATGACAGTG
AACTAAAGAACTTGAAGAACTCAGATGAGTACGCTAAGTTCTGTGAAGAAGAAGATGCAAAGCATTGA
AA sequence
>Potri.012G123700.4 pacid=42782693 polypeptide=Potri.012G123700.4.p locus=Potri.012G123700 ID=Potri.012G123700.4.v4.1 annot-version=v4.1
MASRLLWASRAASYLRISVSHRGFASVVKDLKYAESHEWVKVDGKTATVGITDHAQDHLGDVVYVELPEVGVTVNQGSGFGAVESVKATSDVYSPVSGDV
VEVNEELNSSPGLVNSSPYEKGWIMKVEIKDDSELKNLKNSDEYAKFCEEEDAKH

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT2G35120 Single hybrid motif superfamil... Potri.012G123700 0 1 gdcH1
AT5G17770 CBR1, ATCBR NADH:cytochrome B5 reductase 1... Potri.013G067300 1.00 0.9689
AT1G04750 ATVAMP7B, ATVAM... VESICLE-ASSOCIATED MEMBRANE PR... Potri.003G177700 3.46 0.9495 SAR1.5
AT1G50010 TUA2 tubulin alpha-2 chain (.1) Potri.002G111900 3.74 0.9542
AT4G13940 MEE58, EMB1395,... MATERNAL EFFECT EMBRYO ARREST ... Potri.017G059400 5.47 0.9347 Pt-SAHH.2
AT4G13940 MEE58, EMB1395,... MATERNAL EFFECT EMBRYO ARREST ... Potri.001G320500 9.48 0.9280 SAHH.1
AT2G47360 unknown protein Potri.014G119900 10.19 0.9309
AT4G27435 Protein of unknown function (D... Potri.011G122700 11.22 0.9346
AT5G54240 Protein of unknown function (D... Potri.011G126300 11.22 0.9315
AT4G10955 alpha/beta-Hydrolases superfam... Potri.003G141100 11.22 0.9280
AT5G47870 RAD52-2B, RAD52... radiation sensitive 51-2, unkn... Potri.001G072300 12.72 0.9159

Potri.012G123700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.