Potri.012G124788 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.012G125400 140 / 5e-43 ND /
Potri.012G124832 101 / 9e-28 ND /
Potri.012G124700 96 / 6e-26 ND /
Potri.012G124744 67 / 3e-14 ND /
Potri.012G124666 42 / 3e-05 ND /
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.012G124788.1 pacid=42783209 polypeptide=Potri.012G124788.1.p locus=Potri.012G124788 ID=Potri.012G124788.1.v4.1 annot-version=v4.1
ATGATTCGATGGATAAAAAAGAAGCTACGAAAAACAAAGGTAGTCACAAATAATTATACGGATAACTCCTTCCAGGTTGTTGAGCCAAGTATTTCTGGTA
GTCATAGATTCAATAGTCAAAGTTCATCAGAAGGAAACTCCCTTGAGGATCAACAATCTGTTGGTGAAGAGGGAATAAATTGCTCCGAGTCCCAGATACC
ATCAAACGACGAGGAAATACGACGTCTTAAGAGGCAACTAGATGTAAGAGAGAAGGAATTTGCCAACCTGAGGATCGCCATTCAGTATGCATGTACCGTT
TTGAGCAACGCAGTTACCACTGCTGATGATGCTCTTGAGTTTAAAGACGGAAGTCCCTGTCCTTCCGTTATGAACTGCGGAGGAAATTGCTTTAGAGAAC
AAGACCTCATTGGAGCTGAGCAATCGGTGCCAATTGTAGAATTGTTGGTATCACCATGA
AA sequence
>Potri.012G124788.1 pacid=42783209 polypeptide=Potri.012G124788.1.p locus=Potri.012G124788 ID=Potri.012G124788.1.v4.1 annot-version=v4.1
MIRWIKKKLRKTKVVTNNYTDNSFQVVEPSISGSHRFNSQSSSEGNSLEDQQSVGEEGINCSESQIPSNDEEIRRLKRQLDVREKEFANLRIAIQYACTV
LSNAVTTADDALEFKDGSPCPSVMNCGGNCFREQDLIGAEQSVPIVELLVSP

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.012G124788 0 1
AT1G10340 Ankyrin repeat family protein ... Potri.018G042200 2.23 0.8979
AT2G17040 NAC ANAC036 NAC domain containing protein ... Potri.009G141600 4.24 0.8958
AT1G08450 AtCRT3, PSL1, E... PRIORITY IN SWEET LIFE 1, EMS-... Potri.019G055200 4.47 0.8803
Potri.017G111050 4.89 0.8940
AT4G21700 Protein of unknown function (D... Potri.003G087400 9.89 0.8729
AT5G48380 BIR1 BAK1-interacting receptor-like... Potri.010G178050 14.00 0.8936
AT1G01490 Heavy metal transport/detoxifi... Potri.017G147400 16.43 0.8711
AT1G35520 ARF ARF15 auxin response factor 15 (.1) Potri.004G220100 17.43 0.8409
AT1G45616 AtRLP6 receptor like protein 6 (.1) Potri.012G028500 18.00 0.8274
AT3G18670 Ankyrin repeat family protein ... Potri.015G125000 18.97 0.8750

Potri.012G124788 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.