Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	Pt-RPS20.1
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G62300 221 / 3e-76 Ribosomal protein S10p/S20e family protein (.1.2) AT3G45030 221 / 3e-76 Ribosomal protein S10p/S20e family protein (.1) AT3G47370 215 / 7e-74 Ribosomal protein S10p/S20e family protein (.1.2.3) AT3G13120 53 / 3e-09 Ribosomal protein S10p/S20e family protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G129800 [exp] 247 / 3e-86 AT5G62300 223 / 9e-77 Ribosomal protein S10p/S20e family protein (.1.2) Potri.002G146600 [exp] 206 / 2e-70 AT3G47370 204 / 1e-69 Ribosomal protein S10p/S20e family protein (.1.2.3) Potri.002G116900 [exp] 127 / 1e-39 AT3G47370 125 / 4e-39 Ribosomal protein S10p/S20e family protein (.1.2.3) Potri.001G365600 [exp] 54 / 1e-09 AT3G13120 237 / 4e-80 Ribosomal protein S10p/S20e family protein (.1.2) Potri.011G092800 [exp] 53 / 2e-09 AT3G13120 231 / 1e-77 Ribosomal protein S10p/S20e family protein (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10031705 [exp] 211 / 6e-72 AT5G62300 211 / 5e-72 Ribosomal protein S10p/S20e family protein (.1.2) Lus10031706 [exp] 210 / 7e-72 AT3G45030 202 / 7e-69 Ribosomal protein S10p/S20e family protein (.1) Lus10031126 [exp] 209 / 1e-71 AT3G45030 207 / 2e-70 Ribosomal protein S10p/S20e family protein (.1) Lus10038910 [exp] 203 / 4e-69 AT5G62300 210 / 8e-72 Ribosomal protein S10p/S20e family protein (.1.2) Lus10027194 [exp] 201 / 4e-68 AT5G62300 207 / 2e-70 Ribosomal protein S10p/S20e family protein (.1.2) Lus10031125 [exp] 110 / 2e-32 AT5G62300 113 / 6e-34 Ribosomal protein S10p/S20e family protein (.1.2) Lus10016604 [exp] 56 / 3e-10 AT3G13120 240 / 3e-81 Ribosomal protein S10p/S20e family protein (.1.2) Lus10007111 [exp] 54 / 2e-09 AT3G13120 226 / 3e-75 Ribosomal protein S10p/S20e family protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00338 [poplar] [flax] Ribosomal_S10 Ribosomal protein S10p/S20e
Representative CDS sequence Show only first row Show all	>Potri.012G128300.1 pacid=42784135 polypeptide=Potri.012G128300.1.p locus=Potri.012G128300 ID=Potri.012G128300.1.v4.1 annot-version=v4.1 ATGGCAGCAGCTTATGGAGCTATGAAGGCGCAAAAGCCGGGTTTGGAGGAGACTCAGGAGCAGATTCACAAGATCAGGATCACTCTTTCCTCCAAGGATG TCAAAAACCTTGAGAAAGTTTGCACTGACTTGGTCCGTGGTGCCAAGGATAAGAGACTGAGGGTTAAGGGTCCAGTGAGAATCCCTACCAAGGTTCTTAA CATTACCACCAGGAAATCCCCTTGTGGTGAAGGAACCAACACATGGGACAGATTCGAGCTTCGGGTCCACAAGCGTGTTATTGATCTCTTCAGTTCTGCC GATGTTGTCAAGCAGATCACCTCTATTACAATTGAACCTGGTGTTGAGGTTGAAGTTACCATTGCAGATTAG
AA sequence Show only first row Show all	>Potri.012G128300.1 pacid=42784135 polypeptide=Potri.012G128300.1.p locus=Potri.012G128300 ID=Potri.012G128300.1.v4.1 annot-version=v4.1 MAAAYGAMKAQKPGLEETQEQIHKIRITLSSKDVKNLEKVCTDLVRGAKDKRLRVKGPVRIPTKVLNITTRKSPCGEGTNTWDRFELRVHKRVIDLFSSA DVVKQITSITIEPGVEVEVTIAD

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G62300			Ribosomal protein S10p/S20e fa...		Potri.012G128300 [exp]	0	1	Pt-RPS20.1
AT3G56340			Ribosomal protein S26e family ...		Potri.019G057000 [exp]	1.00	0.9752	RPS26.2
AT2G19730			Ribosomal L28e protein family ...		Potri.003G045500 [exp]	2.44	0.9713
AT1G36240			Ribosomal protein L7Ae/L30e/S1...		Potri.004G196500 [exp]	3.46	0.9611	Pt-RPL30.1
AT5G59850			Ribosomal protein S8 family pr...		Potri.003G114800 [exp]	3.46	0.9663	RPS15.1
AT5G62300			Ribosomal protein S10p/S20e fa...		Potri.015G129800 [exp]	3.60	0.9527	RPS20.2
AT3G04400		EMB2171	embryo defective 2171, Ribosom...		Potri.008G171200 [exp]	4.89	0.9605	RPL23.4
AT1G09690			Translation protein SH3-like f...		Potri.003G159500 [exp]	5.47	0.9627	RPL21.1
AT5G24510			60S acidic ribosomal protein f...		Potri.002G179400 [exp]	6.00	0.9313
AT5G02960			Ribosomal protein S12/S23 fami...		Potri.006G131500 [exp]	7.21	0.9634
AT5G27700			Ribosomal protein S21e (.1)		Potri.005G026000 [exp]	7.93	0.9606

Compare expression of checked genes

Potri.012G128300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.