Potri.012G129000 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G51570 480 / 5e-173 SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
AT5G62740 335 / 7e-116 AtHIR4, ATHIR1 hypersensitive induced reaction 4, HYPERSENSITIVE-INDUCED RESPONSE PROTEIN 1, SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
AT3G01290 329 / 1e-113 AtHIR2 hypersensitive induced reaction 2, SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
AT1G69840 311 / 2e-106 SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1.2.3.4.5.6.7)
AT5G54100 60 / 5e-10 SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
AT4G27585 56 / 1e-08 SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.015G130600 521 / 0 AT5G51570 510 / 0.0 SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
Potri.017G078100 332 / 7e-115 AT5G62740 488 / 3e-176 hypersensitive induced reaction 4, HYPERSENSITIVE-INDUCED RESPONSE PROTEIN 1, SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
Potri.017G078000 325 / 4e-112 AT5G62740 518 / 0.0 hypersensitive induced reaction 4, HYPERSENSITIVE-INDUCED RESPONSE PROTEIN 1, SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
Potri.012G070500 315 / 3e-108 AT5G62740 484 / 3e-175 hypersensitive induced reaction 4, HYPERSENSITIVE-INDUCED RESPONSE PROTEIN 1, SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
Potri.015G065001 188 / 3e-59 AT5G62740 312 / 4e-108 hypersensitive induced reaction 4, HYPERSENSITIVE-INDUCED RESPONSE PROTEIN 1, SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
Potri.015G001900 51 / 4e-07 AT4G27585 499 / 2e-176 SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
Potri.012G005500 49 / 3e-06 AT4G27585 463 / 3e-162 SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
Potri.012G009800 47 / 1e-05 AT4G27585 382 / 3e-130 SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10015032 501 / 0 AT5G51570 532 / 0.0 SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
Lus10038907 496 / 2e-179 AT5G51570 529 / 0.0 SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
Lus10033099 333 / 5e-115 AT5G62740 533 / 0.0 hypersensitive induced reaction 4, HYPERSENSITIVE-INDUCED RESPONSE PROTEIN 1, SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
Lus10007268 332 / 8e-115 AT5G62740 510 / 0.0 hypersensitive induced reaction 4, HYPERSENSITIVE-INDUCED RESPONSE PROTEIN 1, SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
Lus10015356 331 / 4e-114 AT5G62740 506 / 0.0 hypersensitive induced reaction 4, HYPERSENSITIVE-INDUCED RESPONSE PROTEIN 1, SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
Lus10004268 314 / 1e-107 AT5G62740 535 / 0.0 hypersensitive induced reaction 4, HYPERSENSITIVE-INDUCED RESPONSE PROTEIN 1, SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
Lus10037213 314 / 1e-107 AT1G69840 514 / 0.0 SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1.2.3.4.5.6.7)
Lus10036715 311 / 2e-106 AT1G69840 516 / 0.0 SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1.2.3.4.5.6.7)
Lus10032909 54 / 6e-08 AT4G27585 498 / 4e-176 SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
Lus10015597 46 / 2e-05 AT4G27585 383 / 7e-130 SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0433 SPFH PF01145 Band_7 SPFH domain / Band 7 family
Representative CDS sequence
>Potri.012G129000.1 pacid=42784188 polypeptide=Potri.012G129000.1.p locus=Potri.012G129000 ID=Potri.012G129000.1.v4.1 annot-version=v4.1
ATGGGAAGTTCGTTCTGTTTTTTATGTGGCTGTGTAGACCAAGCAAGCGTTGGTGTTATTGAAAGGTGGGGTCGTTTTGAGCGATTAGCTCAACCAGGTT
TCCACTTCTTTAACTGTTTTGTTGGTCAATGTTTAGCCGGTGTTCTGTCTACCAGAATCCACTCTCTTGATGTTCGATGCGAAACCAAAACCAAGGACAA
TGTCTTTGTGCATTTGGTTTGCTCGATTCAGTATCGAGTAGTCAAGGAAAATGCTGATGATGCATTCTATGAGCTCGCAAATCCCAGGGAGCAGATTCAG
GCTTATGTGTTTGATGTGGTTCGAGCTCTCGTTCCAAGAATGACATTGGATGATCTTTTTGAGCAGAAGAGTGAAGTTGCCAAAGCTGTCTTGGAGGAAT
TGGAGAAGGTGATGGGAACCTATGGCTACAGCATAGAGCACATTCTGATGGTTGACATCATACCTGATGATACTGTTCGCAAGGCAATGAACGAGATCAA
TGCAGCTCAACGACTTCAGCTTGCTAGTGTATACAAAGGCGAAGCTGAAAAGGTGTTCCTAGTCAAAAAAGCTGAGGCTGAGGCTGAAGCCAAGTACCTT
GGTGGGGTTGGTGTGGCCAGACAGAGGCAGGCAATCACAGATGGTTTGAGAGAGAACATACTAGAGTTCTCACACAAGGTGGAGGGAACGTCAGCTAAGG
AAGTGATGGATCTCATCATGATCACGCAGTACTTTGACACCATCAAAGACCTCGGCAACTCATCAAAGAACACCACTATTTTTATTCCTCATGGCCCTGG
TCATGTAAGGGATATTAGTGACCAAATTCGCAATGGGATGATGGAGGCATCCAGTGCTCAAATTGATCAGCAGTGA
AA sequence
>Potri.012G129000.1 pacid=42784188 polypeptide=Potri.012G129000.1.p locus=Potri.012G129000 ID=Potri.012G129000.1.v4.1 annot-version=v4.1
MGSSFCFLCGCVDQASVGVIERWGRFERLAQPGFHFFNCFVGQCLAGVLSTRIHSLDVRCETKTKDNVFVHLVCSIQYRVVKENADDAFYELANPREQIQ
AYVFDVVRALVPRMTLDDLFEQKSEVAKAVLEELEKVMGTYGYSIEHILMVDIIPDDTVRKAMNEINAAQRLQLASVYKGEAEKVFLVKKAEAEAEAKYL
GGVGVARQRQAITDGLRENILEFSHKVEGTSAKEVMDLIMITQYFDTIKDLGNSSKNTTIFIPHGPGHVRDISDQIRNGMMEASSAQIDQQ

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G51570 SPFH/Band 7/PHB domain-contain... Potri.012G129000 0 1
AT2G38430 unknown protein Potri.019G029900 3.60 0.8111
AT2G38430 unknown protein Potri.019G029800 5.74 0.7640
AT5G49880 mitotic checkpoint family prot... Potri.003G000900 17.14 0.7356
AT3G05640 Protein phosphatase 2C family ... Potri.010G006100 17.97 0.7540
AT5G50840 unknown protein Potri.010G219700 20.14 0.7997
AT1G72880 Survival protein SurE-like pho... Potri.001G196800 25.27 0.6916
AT5G36290 Uncharacterized protein family... Potri.019G053400 31.74 0.7899
AT5G25265 unknown protein Potri.006G258800 43.88 0.6914
AT2G17790 ZIP3, VPS35A ZIG suppressor 3, VPS35 homolo... Potri.005G110600 56.96 0.7295
Potri.019G129466 57.61 0.7538

Potri.012G129000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.