Potri.012G130100 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G22820 114 / 7e-33 A20/AN1-like zinc finger family protein (.1.2)
AT4G12040 112 / 3e-32 AtSAP7 stress-associated protein 7, A20/AN1-like zinc finger family protein (.1.2)
AT1G12440 110 / 2e-31 A20/AN1-like zinc finger family protein (.1.2)
AT4G14225 99 / 4e-27 A20/AN1-like zinc finger family protein (.1)
AT2G36320 99 / 8e-27 A20/AN1-like zinc finger family protein (.1)
AT4G25380 96 / 4e-26 AtSAP10, SAP10 Arabidopsis thaliana stress-associated protein 10, stress-associated protein 10 (.1)
AT3G52800 90 / 2e-23 A20/AN1-like zinc finger family protein (.1)
AT2G27580 87 / 3e-22 A20/AN1-like zinc finger family protein (.1.2)
AT1G51200 83 / 9e-21 A20/AN1-like zinc finger family protein (.1.2.3.4)
AT3G12630 81 / 8e-20 SAP5 stress associated protein 5, A20/AN1-like zinc finger family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.015G131900 191 / 2e-63 AT4G22820 123 / 2e-36 A20/AN1-like zinc finger family protein (.1.2)
Potri.015G131500 164 / 4e-53 AT4G22820 114 / 3e-33 A20/AN1-like zinc finger family protein (.1.2)
Potri.012G130000 161 / 1e-51 AT4G22820 121 / 1e-35 A20/AN1-like zinc finger family protein (.1.2)
Potri.001G115000 108 / 1e-30 AT4G12040 169 / 4e-54 stress-associated protein 7, A20/AN1-like zinc finger family protein (.1.2)
Potri.007G078500 103 / 7e-29 AT4G12040 120 / 6e-35 stress-associated protein 7, A20/AN1-like zinc finger family protein (.1.2)
Potri.009G144100 101 / 5e-28 AT2G27580 166 / 5e-53 A20/AN1-like zinc finger family protein (.1.2)
Potri.004G184300 96 / 1e-25 AT2G27580 156 / 4e-49 A20/AN1-like zinc finger family protein (.1.2)
Potri.016G051700 95 / 3e-25 AT1G51200 164 / 3e-52 A20/AN1-like zinc finger family protein (.1.2.3.4)
Potri.003G117100 95 / 4e-25 AT1G12440 170 / 2e-54 A20/AN1-like zinc finger family protein (.1.2)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10030150 119 / 7e-35 AT4G12040 119 / 8e-35 stress-associated protein 7, A20/AN1-like zinc finger family protein (.1.2)
Lus10007015 110 / 2e-31 AT1G12440 207 / 3e-69 A20/AN1-like zinc finger family protein (.1.2)
Lus10006671 110 / 2e-31 AT1G12440 204 / 3e-68 A20/AN1-like zinc finger family protein (.1.2)
Lus10003246 107 / 3e-30 AT2G36320 201 / 3e-67 A20/AN1-like zinc finger family protein (.1)
Lus10028903 99 / 7e-27 AT1G12440 205 / 3e-68 A20/AN1-like zinc finger family protein (.1.2)
Lus10008912 97 / 4e-26 AT1G12440 202 / 4e-67 A20/AN1-like zinc finger family protein (.1.2)
Lus10031833 90 / 2e-23 AT1G51200 186 / 5e-61 A20/AN1-like zinc finger family protein (.1.2.3.4)
Lus10035603 89 / 2e-23 AT2G36320 152 / 3e-48 A20/AN1-like zinc finger family protein (.1)
Lus10031262 89 / 7e-23 AT1G51200 187 / 2e-61 A20/AN1-like zinc finger family protein (.1.2.3.4)
Lus10020594 79 / 4e-19 AT2G36320 149 / 2e-46 A20/AN1-like zinc finger family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01428 zf-AN1 AN1-like Zinc finger
PF01754 zf-A20 A20-like zinc finger
Representative CDS sequence
>Potri.012G130100.1 pacid=42784392 polypeptide=Potri.012G130100.1.p locus=Potri.012G130100 ID=Potri.012G130100.1.v4.1 annot-version=v4.1
ATGGACTCGATAAACAGCTCAACTCTTCCTTTGTGTGCCAAGGGTTGCGGGTTCTTTGGTTCTCCAGAGAACGAGAATTTTTGTTCAAAGTGTTATAAAG
AGTATCTCAAAGAAGGGTTAATTGCTGAGCCTTCCAAGAAACTCTCTGAACCTATCGTAGTCACCCCATCTTTTGATGATAATAGCCCAGATGTTGTTAC
CGACGAAACAACTTCAACAACTACTGCTGTTGCATCCACTTCAAAAGTGAAGAATAGATGTGAATGCTGCAACAAGAAAGTTGGTTTGATGGGGTTCGAG
TGCCGCTGTGGGAACACCTTCTGTGGGGTTCATCGATATCCTAAGGAGCACTCTTGTACTTTTGATTTCAAGACTCTTGATCAACAAAATTTGGCCAAGC
AAAATCCACTTGTTGCAGGTGATAAACTTGGTTCCAGAATTTGA
AA sequence
>Potri.012G130100.1 pacid=42784392 polypeptide=Potri.012G130100.1.p locus=Potri.012G130100 ID=Potri.012G130100.1.v4.1 annot-version=v4.1
MDSINSSTLPLCAKGCGFFGSPENENFCSKCYKEYLKEGLIAEPSKKLSEPIVVTPSFDDNSPDVVTDETTSTTTAVASTSKVKNRCECCNKKVGLMGFE
CRCGNTFCGVHRYPKEHSCTFDFKTLDQQNLAKQNPLVAGDKLGSRI

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT4G22820 A20/AN1-like zinc finger famil... Potri.012G130100 0 1
AT1G43890 ATRAB-C1, RAB18... RAB GTPASE HOMOLOG 18-1, ARABI... Potri.002G074400 1.00 0.8304
AT1G06320 unknown protein Potri.005G202500 6.24 0.7738
AT1G75150 unknown protein Potri.002G262800 19.59 0.7560
AT1G65730 YSL7 YELLOW STRIPE like 7 (.1) Potri.005G093800 25.21 0.7639
AT2G19180 unknown protein Potri.018G142900 30.75 0.7300
AT4G22820 A20/AN1-like zinc finger famil... Potri.012G130000 35.29 0.7549
AT5G36170 ATPRFB, HCF109 high chlorophyll fluorescent 1... Potri.008G075800 38.80 0.6547
AT1G30760 FAD-binding Berberine family p... Potri.011G158800 44.54 0.7520
AT5G32470 Haem oxygenase-like, multi-hel... Potri.019G022700 60.53 0.7394
AT1G17890 GER2 NAD(P)-binding Rossmann-fold s... Potri.006G179100 74.47 0.6864

Potri.012G130100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.