Potri.012G130300 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G22860 164 / 2e-45 Cell cycle regulated microtubule associated protein (.1.2)
AT5G07170 130 / 8e-34 Cell cycle regulated microtubule associated protein (.1)
AT4G11990 130 / 3e-33 Cell cycle regulated microtubule associated protein (.1)
AT5G62240 84 / 2e-17 Cell cycle regulated microtubule associated protein (.1)
AT1G03780 66 / 3e-11 AtTPX2, TPX2 targeting protein for XKLP2 (.1.2.3)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G117800 170 / 2e-47 AT4G22860 377 / 8e-126 Cell cycle regulated microtubule associated protein (.1.2)
Potri.001G114400 150 / 2e-40 AT4G22860 353 / 4e-117 Cell cycle regulated microtubule associated protein (.1.2)
Potri.007G138600 57 / 1e-08 AT1G03780 672 / 0.0 targeting protein for XKLP2 (.1.2.3)
Potri.017G013100 51 / 1e-06 AT1G03780 667 / 0.0 targeting protein for XKLP2 (.1.2.3)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10031109 152 / 8e-42 AT5G07170 124 / 6e-31 Cell cycle regulated microtubule associated protein (.1)
Lus10031690 149 / 1e-40 AT4G22860 117 / 2e-29 Cell cycle regulated microtubule associated protein (.1.2)
Lus10007022 142 / 1e-38 AT4G22860 209 / 3e-63 Cell cycle regulated microtubule associated protein (.1.2)
Lus10006677 120 / 2e-29 AT4G22860 345 / 5e-113 Cell cycle regulated microtubule associated protein (.1.2)
Lus10018608 70 / 1e-12 AT1G03780 741 / 0.0 targeting protein for XKLP2 (.1.2.3)
Lus10039844 67 / 1e-11 AT1G03780 689 / 0.0 targeting protein for XKLP2 (.1.2.3)
Lus10017715 45 / 7e-05 AT1G03780 687 / 0.0 targeting protein for XKLP2 (.1.2.3)
Lus10033674 44 / 0.0002 AT1G03780 718 / 0.0 targeting protein for XKLP2 (.1.2.3)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF12214 TPX2_importin Cell cycle regulated microtubule associated protein
Representative CDS sequence
>Potri.012G130300.1 pacid=42784157 polypeptide=Potri.012G130300.1.p locus=Potri.012G130300 ID=Potri.012G130300.1.v4.1 annot-version=v4.1
ATGGATATAGAAATGGAAACGGAAGAAGAATTCGTTGCTGTTGAACCAATCTGGGTCCGAGACGTTGATGGTGATGATGCTGATTTCGATATTGATTACG
AGTTTGATGCTTCAAAATGTTATGATTTTTCGAGGCAAGAAACAGAATTGGAGGCTCAAGAATCTGAATTTTGGTTTGAAATTGCACCAAGTTATCCTCC
TTCACCTTTTGCTATAAAGGCTAAACGGAGACCAAGTTTTGCCTCCTTGGAACCTGCAGAAATTTCAACAGATCATAATAATTATATAGGATTAGAATCT
GATAATCAGATAGTTCAAGATATTGCAAAAGCTGAAGCCAAGTCCCCAGTGAAGTCACCACGATCGAAAAATTCTTTTATGAATCCTACAGCAAGTCAGC
TGGCCAAGAAAAATTGCTGGCCGGAAAATCATTGCAATCGATTGATCAGAAGGTTTACCAAGTTCTCAGTGGAAAATGAAGAGAAAAATTCAAAGGGCTC
TTCTGTTATTGGAAACCAAGCTACCAAAAGGCAAAAGCTCGAGTCTGGTTACTTGCGCAAGGTTGCTTGTTTGAAGCATCAAGCACTCTTTCAGCACAAG
GAACCGAAAAAGGTTGATGAAAGACCCACATTTGGCAGAACAAAAGCCACAATTCCCAGAGAACCTATACTTAGAACATCTTATAGGGCAGAAAGACACA
GGTCTAAGCTTAATTTAGAGTCTGATGAAAATGCGAAACCAAATGCTTCTTGTGCTTTTAAAGCAAGGCCATTGAACAGAAAAATTCTCAGGGCTCCTTC
ATTCCCTCTTCCTAGAAAAAGCGCTCCACAACGGCCAGAATTTCAAGTTTTTCACCTGAGGACATTGGAGAGAGCAAGGACATCGGAGAGGGCTGCTACG
CAACGTTCATCTATTAATAATGCAGCAAATGTATCTAATTCTAATCCTATTTCACAAAATGGAACCACAGACTCTAGAAGTATGATACTTGTTAAGAAGT
TACATCCCTTTCAAAGAGAAAAGTCCAATTCTACCTTGAAGGAGAAATCAGAAGCCCTTGATAAATTTAAACCGCGCTGCCTTAATAGAAAGGAACCAAA
TTCTCCGACTAAGAGGTTTCGGATGAACCTCACGATAGAATCATTTAGTAAGCTCTCCCTGGCATCTGAAGTCCATTCTAATGCAAATGCTCAGACAAAA
TTGCCATTGCAGTATAGGGGCTCGAAAGAGAATGCACCAGGCTGTTTGAACCTATAA
AA sequence
>Potri.012G130300.1 pacid=42784157 polypeptide=Potri.012G130300.1.p locus=Potri.012G130300 ID=Potri.012G130300.1.v4.1 annot-version=v4.1
MDIEMETEEEFVAVEPIWVRDVDGDDADFDIDYEFDASKCYDFSRQETELEAQESEFWFEIAPSYPPSPFAIKAKRRPSFASLEPAEISTDHNNYIGLES
DNQIVQDIAKAEAKSPVKSPRSKNSFMNPTASQLAKKNCWPENHCNRLIRRFTKFSVENEEKNSKGSSVIGNQATKRQKLESGYLRKVACLKHQALFQHK
EPKKVDERPTFGRTKATIPREPILRTSYRAERHRSKLNLESDENAKPNASCAFKARPLNRKILRAPSFPLPRKSAPQRPEFQVFHLRTLERARTSERAAT
QRSSINNAANVSNSNPISQNGTTDSRSMILVKKLHPFQREKSNSTLKEKSEALDKFKPRCLNRKEPNSPTKRFRMNLTIESFSKLSLASEVHSNANAQTK
LPLQYRGSKENAPGCLNL

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT4G22860 Cell cycle regulated microtubu... Potri.012G130300 0 1
AT2G16600 ROC3 rotamase CYP 3 (.1.2) Potri.004G168800 4.24 0.8730 VCCYP.1
AT1G79760 DTA4 downstream target of AGL15-4 (... Potri.001G189400 4.47 0.8732 DTA4.1
AT1G54690 HTA3 ,G-H2AX ,G... histone H2A 3, GAMMA H2AX, gam... Potri.013G028900 9.16 0.8089
AT3G17365 S-adenosyl-L-methionine-depend... Potri.010G153200 9.79 0.8653
AT3G05030 ATNHX2, NHX2 sodium hydrogen exchanger 2 (.... Potri.010G031500 12.64 0.8579 Pt-NHX1.1
AT5G43530 Helicase protein with RING/U-b... Potri.003G083400 20.12 0.8133
AT5G62880 ARAC10, ATRAC10... RHO-RELATED PROTEIN FROM PLANT... Potri.012G077800 20.97 0.8129
AT3G19184 B3 AP2/B3-like transcriptional fa... Potri.009G103100 29.66 0.7950
AT5G26670 Pectinacetylesterase family pr... Potri.010G004400 31.81 0.7565
AT2G44620 MTACP1, MTACP-1 mitochondrial acyl carrier pro... Potri.002G135600 33.46 0.8225

Potri.012G130300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.