Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G62200 150 / 6e-47 Embryo-specific protein 3, (ATS3) (.1) AT2G41475 129 / 6e-39 Embryo-specific protein 3, (ATS3) (.1) AT5G62210 108 / 4e-30 Embryo-specific protein 3, (ATS3) (.1) AT5G07190 90 / 2e-23 ATS3 seed gene 3 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G132700 [exp] 208 / 6e-70 AT5G62200 204 / 1e-67 Embryo-specific protein 3, (ATS3) (.1) Potri.001G193500 [exp] 136 / 8e-42 AT5G62200 184 / 1e-59 Embryo-specific protein 3, (ATS3) (.1) Potri.018G131800 [exp] 123 / 9e-37 AT2G41475 197 / 5e-65 Embryo-specific protein 3, (ATS3) (.1) Potri.006G069800 [exp] 121 / 1e-35 AT2G41475 194 / 1e-63 Embryo-specific protein 3, (ATS3) (.1) Potri.015G132900 [exp] 115 / 5e-33 AT5G62200 153 / 4e-47 Embryo-specific protein 3, (ATS3) (.1) Potri.012G130900 [exp] 106 / 1e-29 AT5G62200 154 / 1e-47 Embryo-specific protein 3, (ATS3) (.1) Potri.010G214400 [exp] 62 / 2e-12 AT5G62200 93 / 7e-24 Embryo-specific protein 3, (ATS3) (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10031684 [exp] 169 / 2e-54 AT5G62200 223 / 5e-75 Embryo-specific protein 3, (ATS3) (.1) Lus10027387 [exp] 169 / 2e-54 AT5G62200 225 / 1e-75 Embryo-specific protein 3, (ATS3) (.1) Lus10019416 [exp] 105 / 1e-29 AT2G41475 179 / 7e-58 Embryo-specific protein 3, (ATS3) (.1) Lus10043273 [exp] 0 / 1 AT2G41475 107 / 7e-32 Embryo-specific protein 3, (ATS3) (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0321 [poplar] [flax] PLAT PF06232 [poplar] [flax] ATS3 Embryo-specific protein 3, (ATS3)
Representative CDS sequence Show only first row Show all	>Potri.012G130800.2 pacid=42783093 polypeptide=Potri.012G130800.2.p locus=Potri.012G130800 ID=Potri.012G130800.2.v4.1 annot-version=v4.1 ATGGATAAAGAGAATGTAGGGAGTTGTTATTACACAGTGGTTATTACAACATGCTGTTCCTCTCCAAGATATACTCGTGATCATATTAGTATTGCTTTCG GTGATGTTTATGGCAATCAGATCTATGCACCAAGGTTGGATGATCCATCGAAAGAACATTTGAACGGTATATGCTATGTCTATCTCTACAGAAGCGGACC AGATGGTTGGAAGCCTGACACCGTGAGGATTTCTGGTTATTCTTCGAGGACTGTTACTTTTACCTACAATACCTACATCCCTAGAGATGTTTGGTACGGA TTTAATTTGTGCCACAATGCCTCTTCTGCACTTCAGCGAGGAATTCCGCAATGGTTTTTGTACATGATCCTCGCGGTTCTTGCTAGTTTTATATTGCTAG TCTAA
AA sequence Show only first row Show all	>Potri.012G130800.2 pacid=42783093 polypeptide=Potri.012G130800.2.p locus=Potri.012G130800 ID=Potri.012G130800.2.v4.1 annot-version=v4.1 MDKENVGSCYYTVVITTCCSSPRYTRDHISIAFGDVYGNQIYAPRLDDPSKEHLNGICYVYLYRSGPDGWKPDTVRISGYSSRTVTFTYNTYIPRDVWYG FNLCHNASSALQRGIPQWFLYMILAVLASFILLV

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G62200			Embryo-specific protein 3, (AT...		Potri.012G130800 [exp]	0	1
AT1G17370		UBP1B	oligouridylate binding protein...		Potri.001G166100 [exp]	4.00	0.6940
					Potri.008G164600 [exp]	22.04	0.6561
AT5G62850		ATVEX1, SWEET5,...	VEGETATIVE CELL EXPRESSED1, No...		Potri.015G074300 [exp]	22.27	0.6345
AT1G09870			histidine acid phosphatase fam...		Potri.008G072600 [exp]	22.91	0.6036
AT5G53450		ORG1	OBP3-responsive gene 1 (.1.2)		Potri.015G016300 [exp]	23.15	0.6554
AT5G09310			unknown protein		Potri.007G106200 [exp]	24.67	0.6363
AT3G19950			RING/U-box superfamily protein...		Potri.005G090500 [exp]	25.74	0.5715
AT1G03990			Long-chain fatty alcohol dehyd...		Potri.002G259700 [exp]	32.68	0.6177
AT3G16520		UGT88A1	UDP-glucosyl transferase 88A1 ...		Potri.015G027800 [exp]	39.03	0.6386
AT4G14420			HR-like lesion-inducing protei...		Potri.002G040900 [exp]	46.66	0.6089

Compare expression of checked genes

Potri.012G130800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.