Plant FIBer expression Database

Potri.012G132766 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G51840 89 / 3e-23 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.015G135000
[exp]
104 / 2e-29 AT5G51840 219 / 1e-71 unknown protein
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10031667
[exp]
81 / 5e-20 AT5G51840 271 / 1e-91 unknown protein
PFAM info
Representative CDS sequence
>Potri.012G132766.1 pacid=42783435 polypeptide=Potri.012G132766.1.p locus=Potri.012G132766 ID=Potri.012G132766.1.v4.1 annot-version=v4.1
ATGCCGTCGTCGTCGTCGTCGTCGTCATCTCCAAATCCGTCGACGATGCTTAAACCAGAGGTCGGACCTGACAGTCTTCCTCGAGAAGCTCCTGTCATTG
CCTACACCGAGAAGATAATCGAAGAAGAGCAACTTCAATTAAGGAAATATATTGAAGAAAATTATTCGAAGATTCGTGATGTAGAGATAAAGCTAGCGAA
TCTTACGTTAAAGCAGGCTTAA
AA sequence
>Potri.012G132766.1 pacid=42783435 polypeptide=Potri.012G132766.1.p locus=Potri.012G132766 ID=Potri.012G132766.1.v4.1 annot-version=v4.1
MPSSSSSSSSPNPSTMLKPEVGPDSLPREAPVIAYTEKIIEEEQLQLRKYIEENYSKIRDVEIKLANLTLKQA

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G51840 unknown protein Potri.012G132766
[exp]
0 1
AT5G55180 O-Glycosyl hydrolases family 1... Potri.011G094400
[exp]
5.65 0.9226
AT3G54770 RNA-binding (RRM/RBD/RNP motif... Potri.010G216800
[exp]
8.30 0.9096
Potri.009G092300
[exp]
9.16 0.9197 AGP9.1
AT1G30630 Coatomer epsilon subunit (.1) Potri.011G155800
[exp]
22.89 0.9093 COPE2.1
AT4G12560 CPR1, CPR30 CONSTITUTIVE EXPRESSER OF PR G... Potri.003G145950
[exp]
28.49 0.8775
AT5G42560 Abscisic acid-responsive (TB2/... Potri.005G237900
[exp]
31.22 0.9029
AT2G38710 AMMECR1 family (.1.2) Potri.008G019325
[exp]
31.62 0.8802
AT5G59410 Rab5-interacting family protei... Potri.001G241500
[exp]
32.00 0.8985
AT5G13710 CPH, SMT1 CEPHALOPOD, sterol methyltrans... Potri.001G263700
[exp]
33.22 0.8946
AT3G44330 unknown protein Potri.004G198200
[exp]
35.87 0.8937

Potri.012G132766 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.