Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G62165 218 / 3e-72 MADS FYF, AGL42 FOREVER YOUNG FLOWER, AGAMOUS-like 42 (.1.2.3.4.5) AT2G45660 200 / 4e-65 MADS ATSOC1, SOC1, AGL20 SUPPRESSOR OF OVEREXPRESSION OF CO 1, AGAMOUS-like 20 (.1) AT5G51870 191 / 2e-61 MADS AGL71 AGAMOUS-like 71 (.1.2.3) AT5G51860 182 / 2e-58 MADS AGL72 AGAMOUS-like 72, K-box region and MADS-box transcription factor family protein (.1.2) AT4G22950 182 / 6e-58 MADS AGL19 AGAMOUS-like 19 (.1) AT4G11880 173 / 3e-54 MADS AGL14 AGAMOUS-like 14 (.1) AT1G69120 152 / 1e-45 MADS AGL7, AP1 APETALA1, AGAMOUS-like 7, K-box region and MADS-box transcription factor family protein (.1) AT5G60910 149 / 8e-45 MADS FUL, AGL8 FRUITFULL, AGAMOUS-like 8 (.1.2) AT4G09960 145 / 2e-43 MADS AGL11, STK SEEDSTICK, AGAMOUS-like 11, K-box region and MADS-box transcription factor family protein (.1.2.3.4) AT1G24260 145 / 4e-43 MADS AGL9, SEP3 SEPALLATA3, AGAMOUS-like 9, K-box region and MADS-box transcription factor family protein (.1.2.3)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G074200 [exp] 226 / 4e-75 AT2G45660 242 / 3e-81 SUPPRESSOR OF OVEREXPRESSION OF CO 1, AGAMOUS-like 20 (.1) Potri.002G151700 [exp] 222 / 1e-73 AT2G45660 212 / 8e-70 SUPPRESSOR OF OVEREXPRESSION OF CO 1, AGAMOUS-like 20 (.1) Potri.001G112400 [exp] 206 / 3e-67 AT4G22950 253 / 6e-86 AGAMOUS-like 19 (.1) Potri.003G119700 [exp] 204 / 2e-66 AT4G11880 226 / 4e-75 AGAMOUS-like 14 (.1) Potri.004G115500 [exp] 149 / 8e-45 AT3G02310 357 / 4e-126 SEPALLATA 2, AGAMOUS-like 4, K-box region and MADS-box transcription factor family protein (.1) Potri.019G077200 [exp] 147 / 2e-44 AT4G09960 274 / 5e-94 SEEDSTICK, AGAMOUS-like 11, K-box region and MADS-box transcription factor family protein (.1.2.3.4) Potri.010G154100 [exp] 148 / 4e-44 AT1G69120 324 / 7e-113 APETALA1, AGAMOUS-like 7, K-box region and MADS-box transcription factor family protein (.1) Potri.013G104900 [exp] 147 / 4e-44 AT4G09960 330 / 3e-116 SEEDSTICK, AGAMOUS-like 11, K-box region and MADS-box transcription factor family protein (.1.2.3.4) Potri.017G099700 [exp] 147 / 8e-44 AT3G02310 372 / 8e-132 SEPALLATA 2, AGAMOUS-like 4, K-box region and MADS-box transcription factor family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10006715 [exp] 185 / 1e-58 AT4G22950 223 / 1e-73 AGAMOUS-like 19 (.1) Lus10014143 [exp] 173 / 7e-54 AT4G22950 212 / 6e-69 AGAMOUS-like 19 (.1) Lus10031665 [exp] 155 / 3e-48 AT5G62165 179 / 8e-58 FOREVER YOUNG FLOWER, AGAMOUS-like 42 (.1.2.3.4.5) Lus10026679 [exp] 145 / 2e-43 AT1G69120 338 / 1e-118 APETALA1, AGAMOUS-like 7, K-box region and MADS-box transcription factor family protein (.1) Lus10005080 [exp] 145 / 7e-43 AT3G02310 372 / 1e-131 SEPALLATA 2, AGAMOUS-like 4, K-box region and MADS-box transcription factor family protein (.1) Lus10034663 [exp] 145 / 7e-43 AT5G15800 267 / 4e-90 SEPALLATA1, AGAMOUS-like 2, K-box region and MADS-box transcription factor family protein (.1.2) Lus10008264 [exp] 145 / 1e-42 AT4G09960 328 / 3e-114 SEEDSTICK, AGAMOUS-like 11, K-box region and MADS-box transcription factor family protein (.1.2.3.4) Lus10004637 [exp] 143 / 1e-42 AT1G69120 318 / 2e-111 APETALA1, AGAMOUS-like 7, K-box region and MADS-box transcription factor family protein (.1) Lus10005302 [exp] 143 / 6e-42 AT4G09960 330 / 2e-115 SEEDSTICK, AGAMOUS-like 11, K-box region and MADS-box transcription factor family protein (.1.2.3.4) Lus10003125 [exp] 139 / 2e-41 AT1G24260 290 / 9e-101 SEPALLATA3, AGAMOUS-like 9, K-box region and MADS-box transcription factor family protein (.1.2.3)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00319 [poplar] [flax] SRF-TF SRF-type transcription factor (DNA-binding and dimerisation domain) PF01486 [poplar] [flax] K-box K-box region
Representative CDS sequence Show only first row Show all	>Potri.012G133000.6 pacid=42782553 polypeptide=Potri.012G133000.6.p locus=Potri.012G133000 ID=Potri.012G133000.6.v4.1 annot-version=v4.1 ATGGCGAGAGGAAAGGTTCAGCTGAAAAGGATAGAGAATGCAACTAGCAGGCAAGTGACCTTCTCCAAGAGAAAAAATGGGTTATTGAAGAAAGCTTATG AGCTATCAATTCTGTGCGATGCTGAAGTTGCAGTGATCATGTTTTCACAGAAAGGAACACTCTTTAAGTTTGCAAGCATTGATCAGATACAAAAGACGAT TGATCGGTACCGTAAAAATGCAAAGCAATTGCACACTGACAGGATTGATGTGGAACAATCTAAGGAGCAATTAAGACAAGAATCAGCAAACATGGCCAAG AAGATTGAGATGATCGAGATTTTGCAACGAAAGCTTTTAGGGCAAGATTTAGATTCATGTTCTCCCGAAGAGCTCCATGACATTGACAATCAGCTTGAGA TCAGTTTAAGCAATATCAGGGCTAGAAAGACTCAGTTATTCAAGGAGCAGATAGAACAGCTGCAAGCAAAGGAAAGATTGTTGTTAATGGAGAATGCAAG GTTAACTAAACAGTGTGATGCACAGCCATTGCAGCAATCAACTCAATCGAACCAAGTGGTGTCATACTTGACCTCATGTAGCAAGAGTTCAGATATCGTG GAGACTGATCTGTACATTGGACTGCCACACATGCGCTGCTTGTAG
AA sequence Show only first row Show all	>Potri.012G133000.6 pacid=42782553 polypeptide=Potri.012G133000.6.p locus=Potri.012G133000 ID=Potri.012G133000.6.v4.1 annot-version=v4.1 MARGKVQLKRIENATSRQVTFSKRKNGLLKKAYELSILCDAEVAVIMFSQKGTLFKFASIDQIQKTIDRYRKNAKQLHTDRIDVEQSKEQLRQESANMAK KIEMIEILQRKLLGQDLDSCSPEELHDIDNQLEISLSNIRARKTQLFKEQIEQLQAKERLLLMENARLTKQCDAQPLQQSTQSNQVVSYLTSCSKSSDIV ETDLYIGLPHMRCL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G62165	MADS	FYF, AGL42	FOREVER YOUNG FLOWER, AGAMOUS-...		Potri.012G133000 [exp]	0	1
AT1G08465	YABBY	YAB2	YABBY2, Plant-specific transcr...		Potri.016G067300 [exp]	1.41	0.9602
AT2G17220		Kin3	kinase 3, Protein kinase super...		Potri.018G135300 [exp]	3.46	0.9578
AT2G46320			Mitochondrial substrate carrie...		Potri.002G167700 [exp]	5.65	0.9456
AT2G28120			Major facilitator superfamily ...		Potri.009G006400 [exp]	7.54	0.9236
AT3G19660			unknown protein		Potri.017G109900 [exp]	8.48	0.9345
					Potri.005G182750 [exp]	9.21	0.9447
AT1G33270			Acyl transferase/acyl hydrolas...		Potri.001G209500 [exp]	10.58	0.9360
					Potri.006G069900 [exp]	14.28	0.9410
AT5G38660		APE1	acclimation of photosynthesis ...		Potri.004G102100 [exp]	22.44	0.9253
AT2G42130			Plastid-lipid associated prote...		Potri.016G045900 [exp]	28.61	0.9136

Compare expression of checked genes

Potri.012G133000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.