Potri.012G136500 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.012G136500.1 pacid=42784003 polypeptide=Potri.012G136500.1.p locus=Potri.012G136500 ID=Potri.012G136500.1.v4.1 annot-version=v4.1
ATGAAGGGAAATCAATATGGAAACGATTCAAATTATTGGGATACCCTTGAATCTAGACTTTTTGAACGGTTTTTAGCTGATCCTGACCGCAGTTCAGACT
CTTATCGGCACTATGGCACATACTCCCAGTATGAATCATACGAAGACGATGGCAATATTGCATCCTATTATCGTGGTTCTTATGAAAACAGAAACCAGGG
ACAGCGCTCAGGGCAGGCGGCTGGAGGTTCATGGCTGGATAATGAAGTTATGGCTAGACAACTACAGGAGATGTCAATATATGGTGAAGACTCAGGAAGC
ACAACTAGTTAG
AA sequence
>Potri.012G136500.1 pacid=42784003 polypeptide=Potri.012G136500.1.p locus=Potri.012G136500 ID=Potri.012G136500.1.v4.1 annot-version=v4.1
MKGNQYGNDSNYWDTLESRLFERFLADPDRSSDSYRHYGTYSQYESYEDDGNIASYYRGSYENRNQGQRSGQAAGGSWLDNEVMARQLQEMSIYGEDSGS
TTS

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.012G136500 0 1
Potri.002G113501 3.74 0.8389
AT1G78720 SecY protein transport family ... Potri.011G114200 5.09 0.9168
AT5G58200 Calcineurin-like metallo-phosp... Potri.018G111500 7.21 0.9168
Potri.001G174350 10.19 0.8859
AT2G20800 NDB4 NAD(P)H dehydrogenase B4 (.1) Potri.013G147400 15.29 0.6572
AT5G26330 Cupredoxin superfamily protein... Potri.004G171100 17.97 0.7578
AT5G28780 PIF1 helicase (.1) Potri.007G048501 23.23 0.7565
AT2G32835 RALFL16 RALF-like 16 (.1) Potri.018G007800 30.19 0.5791
Potri.004G151450 38.34 0.7377
AT3G22780 CPP ATTSO1, TSO1 CHINESE FOR 'UGLY', Tesmin/TSO... Potri.001G173600 39.11 0.5758 Pt-CPP1.21

Potri.012G136500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.