Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G53020 227 / 4e-77 RPL24B, STV1 SHORT VALVE1, Ribosomal protein L24e family protein (.1) AT2G36620 227 / 4e-77 RPL24A ribosomal protein L24 (.1) AT2G44860 75 / 2e-17 Ribosomal protein L24e family protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G139400 [exp] 256 / 8e-89 AT3G53020 227 / 3e-77 SHORT VALVE1, Ribosomal protein L24e family protein (.1) Potri.015G141900 [exp] 249 / 8e-86 AT3G53020 196 / 3e-65 SHORT VALVE1, Ribosomal protein L24e family protein (.1) Potri.004G085300 [exp] 243 / 2e-83 AT3G53020 199 / 2e-66 SHORT VALVE1, Ribosomal protein L24e family protein (.1) Potri.003G123101 [exp] 223 / 1e-75 AT3G53020 218 / 8e-74 SHORT VALVE1, Ribosomal protein L24e family protein (.1) Potri.004G187800 [exp] 78 / 2e-18 AT2G44860 249 / 8e-86 Ribosomal protein L24e family protein (.1.2) Potri.009G148500 [exp] 76 / 6e-18 AT2G44860 248 / 1e-85 Ribosomal protein L24e family protein (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10008640 [exp] 232 / 3e-79 AT2G36620 243 / 1e-83 ribosomal protein L24 (.1) Lus10035584 [exp] 232 / 3e-79 AT2G36620 241 / 5e-83 ribosomal protein L24 (.1) Lus10024560 [exp] 225 / 2e-76 AT2G36620 238 / 2e-81 ribosomal protein L24 (.1) Lus10032198 [exp] 225 / 2e-76 AT2G36620 240 / 1e-82 ribosomal protein L24 (.1) Lus10006314 [exp] 219 / 4e-73 AT2G36620 233 / 2e-78 ribosomal protein L24 (.1) Lus10029583 [exp] 219 / 7e-73 AT2G36620 232 / 4e-78 ribosomal protein L24 (.1) Lus10014637 [exp] 103 / 4e-29 AT2G36620 100 / 6e-28 ribosomal protein L24 (.1) Lus10020552 [exp] 82 / 7e-20 AT2G44860 240 / 2e-82 Ribosomal protein L24e family protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0175 [poplar] [flax] TRASH PF01246 [poplar] [flax] Ribosomal_L24e Ribosomal protein L24e
Representative CDS sequence Show only first row Show all	>Potri.012G139500.1 pacid=42784035 polypeptide=Potri.012G139500.1.p locus=Potri.012G139500 ID=Potri.012G139500.1.v4.1 annot-version=v4.1 ATGGTTCTCAAGACTGAACTCTGCCGCTTCAGTGGGGCGAAGATCTATCCTGGCAAGGGTATCAGATTTATTCGCTCAGATTCCCAGGTCTTCCTCTTTG CCAATTCTAAATGCAAGAGGTACTTCCACAACAGGCTGAAGCCCTCAAAGCTAACCTGGACAGCTATGTACAGGAAGCAGCATAAAAAGGACATTGCTGC AGAAACTATTAAGAAGAGGCGTCGCGCCACGAAAAAACCTTACTCAAGGTCCATTGTAGGTGCTACTTTGGAGGTCATACAGAAGAAGCGAACTGAGAAA CCTGAAGTTCGTGATGCTGCAAGGGAGGCTGCACTCCGTGAAATTAAGGAGAGGATTAAGAAATCAAAGGATGAGAAGAGAGCCAAGAAGGCTGAGGTAA CAGCCAAGGTACAAAAGAGCAGCAAAGGTAGCGTGCCAAAGGGCGCTGCACCAAAGGGCCCCAAGCTTGGCGGGGGTGGAGGAAAGCGGTGA
AA sequence Show only first row Show all	>Potri.012G139500.1 pacid=42784035 polypeptide=Potri.012G139500.1.p locus=Potri.012G139500 ID=Potri.012G139500.1.v4.1 annot-version=v4.1 MVLKTELCRFSGAKIYPGKGIRFIRSDSQVFLFANSKCKRYFHNRLKPSKLTWTAMYRKQHKKDIAAETIKKRRRATKKPYSRSIVGATLEVIQKKRTEK PEVRDAAREAALREIKERIKKSKDEKRAKKAEVTAKVQKSSKGSVPKGAAPKGPKLGGGGGKR

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G53020		RPL24B, STV1	SHORT VALVE1, Ribosomal protei...		Potri.012G139500 [exp]	0	1
AT5G07090			Ribosomal protein S4 (RPS4A) f...		Potri.015G079600 [exp]	2.44	0.9598
AT5G09500			Ribosomal protein S19 family p...		Potri.005G219700 [exp]	3.00	0.9653
AT3G04840			Ribosomal protein S3Ae (.1)		Potri.008G156300 [exp]	6.32	0.9629	RS3.2
AT3G04400		EMB2171	embryo defective 2171, Ribosom...		Potri.003G136400 [exp]	7.21	0.9385
AT5G35530			Ribosomal protein S3 family pr...		Potri.006G222100 [exp]	8.36	0.9602
AT4G09800		RPS18C	S18 ribosomal protein (.1)		Potri.005G211200 [exp]	8.83	0.9625
AT1G74270			Ribosomal protein L35Ae family...		Potri.008G059400 [exp]	9.00	0.9518
AT3G05590		RPL18	ribosomal protein L18 (.1)		Potri.014G127300 [exp]	9.16	0.9623	RPL18.10
AT3G53020		RPL24B, STV1	SHORT VALVE1, Ribosomal protei...		Potri.003G123101 [exp]	12.12	0.9556
AT2G09990			Ribosomal protein S5 domain 2-...		Potri.008G150000 [exp]	14.69	0.9542

Compare expression of checked genes

Potri.012G139500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.