Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G62065 101 / 5e-29 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT5G01870 47 / 8e-08 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT3G08770 46 / 2e-07 LTP6 lipid transfer protein 6 (.1.2) AT3G51600 45 / 4e-07 LTP5 lipid transfer protein 5 (.1) AT5G59310 44 / 1e-06 LTP4 lipid transfer protein 4 (.1) AT5G44265 43 / 3e-06 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT3G51590 42 / 7e-06 LTP12 lipid transfer protein 12 (.1) AT2G15325 42 / 9e-06 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT2G38540 41 / 3e-05 ATLTP1, LP1 ARABIDOPSIS THALIANA LIPID TRANSFER PROTEIN 1, lipid transfer protein 1 (.1) AT5G59320 40 / 4e-05 LTP3 lipid transfer protein 3 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G142100 [exp] 119 / 2e-36 AT5G62065 62 / 5e-14 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.016G135800 [exp] 54 / 2e-10 AT5G01870 111 / 1e-32 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.016G136000 [exp] 53 / 4e-10 AT5G01870 113 / 1e-33 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.001G232900 [exp] 51 / 3e-09 AT2G18370 100 / 3e-28 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.004G086600 [exp] 50 / 8e-09 AT2G38540 122 / 3e-37 ARABIDOPSIS THALIANA LIPID TRANSFER PROTEIN 1, lipid transfer protein 1 (.1) Potri.001G232700 [exp] 49 / 2e-08 AT2G18370 93 / 1e-25 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.016G135700 [exp] 48 / 4e-08 AT5G59310 92 / 3e-25 lipid transfer protein 4 (.1) Potri.009G025200 [exp] 48 / 5e-08 AT2G18370 86 / 6e-23 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.004G086500 [exp] 47 / 2e-07 AT2G38540 124 / 5e-38 ARABIDOPSIS THALIANA LIPID TRANSFER PROTEIN 1, lipid transfer protein 1 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10014998 [exp] 129 / 2e-38 AT5G62065 125 / 1e-36 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10012384 [exp] 50 / 5e-09 AT5G59310 76 / 4e-19 lipid transfer protein 4 (.1) Lus10028055 [exp] 50 / 1e-08 AT5G59310 66 / 9e-15 lipid transfer protein 4 (.1) Lus10012383 [exp] 49 / 2e-08 AT5G59310 64 / 4e-14 lipid transfer protein 4 (.1) Lus10025148 [exp] 49 / 3e-08 AT5G01870 105 / 6e-30 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10025230 [exp] 49 / 3e-08 AT3G08770 105 / 4e-30 lipid transfer protein 6 (.1.2) Lus10028002 [exp] 49 / 4e-08 AT5G59310 64 / 3e-14 lipid transfer protein 4 (.1) Lus10028003 [exp] 49 / 4e-08 AT5G59310 64 / 3e-14 lipid transfer protein 4 (.1) Lus10022745 [exp] 46 / 3e-07 AT5G59310 103 / 1e-29 lipid transfer protein 4 (.1) Lus10014167 [exp] 46 / 4e-07 AT5G59310 102 / 2e-29 lipid transfer protein 4 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.012G139700.1 pacid=42784186 polypeptide=Potri.012G139700.1.p locus=Potri.012G139700 ID=Potri.012G139700.1.v4.1 annot-version=v4.1 ATGGAGGTCCAAAAAAGAATGACTGGAGTGCTCCTGTTGCTGTTGCTCTCATGGGCTGTGACAGTGGCGGCCGACGTCGATTGCACGACCGTGACAGGGT TCCTCACGGCTTGCTCTACATTCATCACCTATGGCACACCAGACCCACTTCCAGGCTCACCATGTTGTGATTCCATGATGAGCCTCAATGTGATTGCTGA ATCTGGAAATGATAGGAGGTCTATCTGTCTATGCTTAATGGGCCTCATCACTACCTATAATCCTAATGCTACAGCAATTGCTACTCTGCCTGGCTTCTGT GGATTAAGCCTTGGCTTCATTCTTGATCCTAATACAGATTGCTCCTCTGTTCCTTGA
AA sequence Show only first row Show all	>Potri.012G139700.1 pacid=42784186 polypeptide=Potri.012G139700.1.p locus=Potri.012G139700 ID=Potri.012G139700.1.v4.1 annot-version=v4.1 MEVQKRMTGVLLLLLLSWAVTVAADVDCTTVTGFLTACSTFITYGTPDPLPGSPCCDSMMSLNVIAESGNDRRSICLCLMGLITTYNPNATAIATLPGFC GLSLGFILDPNTDCSSVP

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G62065			Bifunctional inhibitor/lipid-t...		Potri.012G139700 [exp]	0	1
AT2G34770		ATFAH1, FAH1	ARABIDOPSIS FATTY ACID HYDROXY...		Potri.001G463800 [exp]	15.23	0.6604	FAH1.2
AT5G14210			Leucine-rich repeat protein ki...		Potri.001G333300 [exp]	45.34	0.6043
AT4G32980	HD	ATH1	homeobox gene 1 (.1)		Potri.018G054700 [exp]	106.89	0.5495
AT1G02610			RING/FYVE/PHD zinc finger supe...		Potri.002G196600 [exp]	145.93	0.4967

Compare expression of checked genes

Potri.012G139700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.