Potri.012G140001 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G73040 216 / 3e-72 Mannose-binding lectin superfamily protein (.1)
AT1G19715 110 / 3e-28 Mannose-binding lectin superfamily protein (.1.2.3)
AT3G16460 86 / 2e-19 JAL34 jacalin-related lectin 34, Mannose-binding lectin superfamily protein (.1.2)
AT1G52060 81 / 2e-18 Mannose-binding lectin superfamily protein (.1)
AT3G16420 79 / 1e-17 JAL30, PBP1 JACALIN-RELATED LECTIN 30, PYK10-binding protein 1 (.1.2.3)
AT2G25980 79 / 2e-17 Mannose-binding lectin superfamily protein (.1)
AT1G52070 79 / 2e-17 Mannose-binding lectin superfamily protein (.1)
AT3G16430 78 / 3e-17 JAL31 jacalin-related lectin 31 (.1.2)
AT3G16440 77 / 6e-17 ATMLP-300B, MEE36 maternal effect embryo arrest 36, myrosinase-binding protein-like protein-300B (.1)
AT3G16470 77 / 6e-17 JAL35, JR1 JASMONATE RESPONSIVE 1, jacalin-related lectin 35, Mannose-binding lectin superfamily protein (.1.2.3)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G232400 135 / 5e-37 AT1G19715 609 / 0.0 Mannose-binding lectin superfamily protein (.1.2.3)
Potri.005G232500 131 / 8e-36 AT1G19715 486 / 2e-166 Mannose-binding lectin superfamily protein (.1.2.3)
Potri.002G030400 129 / 1e-34 AT1G19715 590 / 0.0 Mannose-binding lectin superfamily protein (.1.2.3)
Potri.017G010900 73 / 4e-15 AT3G16460 135 / 5e-34 jacalin-related lectin 34, Mannose-binding lectin superfamily protein (.1.2)
Potri.010G144900 47 / 7e-07 AT1G05760 92 / 5e-24 restricted tev movement 1, Mannose-binding lectin superfamily protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10037605 195 / 1e-61 AT1G73040 198 / 1e-62 Mannose-binding lectin superfamily protein (.1)
Lus10006866 195 / 2e-58 AT1G73040 194 / 5e-58 Mannose-binding lectin superfamily protein (.1)
Lus10024290 134 / 1e-36 AT1G19715 607 / 0.0 Mannose-binding lectin superfamily protein (.1.2.3)
Lus10024291 130 / 4e-35 AT1G19715 438 / 1e-146 Mannose-binding lectin superfamily protein (.1.2.3)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0568 Man_lectin PF01419 Jacalin Jacalin-like lectin domain
Representative CDS sequence
>Potri.012G140001.1 pacid=42782980 polypeptide=Potri.012G140001.1.p locus=Potri.012G140001 ID=Potri.012G140001.1.v4.1 annot-version=v4.1
ATGGAAAATGGGAAGGAACAATCAGCTGCGAGAAAGAAGAGCACCATATTAGTTGGACCATGGGGAGGGAATGGAGGGGATAGCTGGGATGATGGGATCT
ACCATGGAGTAAGAGAAATCACAATTGTTTATGATCAATGCATCGACTCGATCCAGGTTGTGTATGACAAGAATGGCAAGCCTATCACAGCAGAAAACCA
TGGAGGTGTTGGAGGCAGTAGAACAGCTGAGATTAAGTTGCAATATCCGGAGGAGTACTTAACCAGTGTGAGTGGCCATTACTGCCCGGTAGTCTATGGT
GGCAGTCCTGTGATTCGATCGTTAGCATTCAGCAGCAACAAAAGAACATTTGGACCATTTGGAGTTGAAGAAGGAACGCCATTTACACTTTCAATGGACG
GAGCATCGATTGTAGGCTTTAAGGGTAGAGGTGGATGGTATCTTGATGCCATTGGGTTTCGTTTATCTCGTATTCAATCCACCAAAGTTCTCAAAAAATT
TCAACAAAAGCTTCAAAGGCTCACCAGTACGGTTTCAAAGTCCTCTGCCTCCAAGGATGCTGAAAAAACCTATTGA
AA sequence
>Potri.012G140001.1 pacid=42782980 polypeptide=Potri.012G140001.1.p locus=Potri.012G140001 ID=Potri.012G140001.1.v4.1 annot-version=v4.1
MENGKEQSAARKKSTILVGPWGGNGGDSWDDGIYHGVREITIVYDQCIDSIQVVYDKNGKPITAENHGGVGGSRTAEIKLQYPEEYLTSVSGHYCPVVYG
GSPVIRSLAFSSNKRTFGPFGVEEGTPFTLSMDGASIVGFKGRGGWYLDAIGFRLSRIQSTKVLKKFQQKLQRLTSTVSKSSASKDAEKTY

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G73040 Mannose-binding lectin superfa... Potri.012G140001 0 1
AT1G24620 EF hand calcium-binding protei... Potri.002G088500 2.00 0.9069
AT2G16050 Cysteine/Histidine-rich C1 dom... Potri.009G110500 2.44 0.8754
AT5G59970 Histone superfamily protein (.... Potri.018G093000 5.29 0.8413 HFO907,Pt-HIS4.1
AT4G31240 protein kinase C-like zinc fin... Potri.006G279400 7.21 0.8692
AT1G10155 ATPP2-A10 phloem protein 2-A10 (.1) Potri.012G120340 7.48 0.8614
AT1G10155 ATPP2-A10 phloem protein 2-A10 (.1) Potri.015G120200 8.36 0.8637
AT5G56350 Pyruvate kinase family protein... Potri.013G060400 8.48 0.8698
AT3G58720 RING/U-box superfamily protein... Potri.014G139400 10.95 0.8642
Potri.012G085800 11.61 0.8671
AT4G36760 ATAPP1 ARABIDOPSIS THALIANA AMINOPEPT... Potri.007G029700 12.00 0.8296 APP1.2

Potri.012G140001 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.