Potri.012G140600 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G52270 212 / 9e-70 SNARE-like superfamily protein (.1)
AT1G11890 152 / 4e-46 ATSEC22, SEC22 SECRETION 22, Synaptobrevin family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G165600 149 / 5e-45 AT1G11890 427 / 9e-155 SECRETION 22, Synaptobrevin family protein (.1)
Potri.003G069900 148 / 2e-44 AT1G11890 429 / 2e-155 SECRETION 22, Synaptobrevin family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10013175 148 / 2e-44 AT1G11890 411 / 2e-148 SECRETION 22, Synaptobrevin family protein (.1)
Lus10036987 144 / 6e-43 AT1G11890 415 / 6e-150 SECRETION 22, Synaptobrevin family protein (.1)
Lus10008135 135 / 5e-39 AT1G11890 363 / 7e-129 SECRETION 22, Synaptobrevin family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0431 PF PF13774 Longin Regulated-SNARE-like domain
Representative CDS sequence
>Potri.012G140600.1 pacid=42783506 polypeptide=Potri.012G140600.1.p locus=Potri.012G140600 ID=Potri.012G140600.1.v4.1 annot-version=v4.1
ATGGTTAAGATAACAATAGTTGGAAGGGTGATTGATGGGCTGCCTCTTGCCCAAGGGCCTAGGTATGTGAATGAAGAGAATGATAATTTCTTATGTTACA
AGCAACAAGGTGAGTTCATACTCAAAGAAATCTCAAGAGGAGCCTTGATACCTTCCATGATGACCATTCGCATTGATCATCACTCTCTCAACTACTTGAT
TGGGAATGGTGCCTGCTTCATGACATTATGCGATTCTTCATATCCAAGAAAGCTAGCTTTCCATTATCTACAAGACTTGCAAAAGGAGTTTGAGAGATTG
GACAATAGCCTAGTTGAGAAAATTACAAGACCATATAGTTTTGTTAAATTCGATGGTGTTATTGGGAGTATTAGGAAGCAGTATATAGACACGAGAACTC
AGGCTAATCTATCGAAGCTAAATGCGAATAGAAAAAAAGATTTAGAAATCATCACAGAGCACATATCAGAAATTCTGCAAAGAAAAAGAAATTCAGAAAT
CTCCGAAAGACTACCGGCAACGACTCCAAGAACAGCCTCTCCTGTCTGGGGTTCTCCCCTGCTAGAGGTGATTGCACTGAAATGGACACCAATTACAACC
ATTGTTGCAGTTGCTGCTATCCTGTTATGGGCAAGCCTAGTTCTCACAGATAATTTTATCATCTAG
AA sequence
>Potri.012G140600.1 pacid=42783506 polypeptide=Potri.012G140600.1.p locus=Potri.012G140600 ID=Potri.012G140600.1.v4.1 annot-version=v4.1
MVKITIVGRVIDGLPLAQGPRYVNEENDNFLCYKQQGEFILKEISRGALIPSMMTIRIDHHSLNYLIGNGACFMTLCDSSYPRKLAFHYLQDLQKEFERL
DNSLVEKITRPYSFVKFDGVIGSIRKQYIDTRTQANLSKLNANRKKDLEIITEHISEILQRKRNSEISERLPATTPRTASPVWGSPLLEVIALKWTPITT
IVAVAAILLWASLVLTDNFII

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G52270 SNARE-like superfamily protein... Potri.012G140600 0 1
AT3G63240 DNAse I-like superfamily prote... Potri.002G050000 4.47 0.8677
Potri.014G003451 14.56 0.8722
AT5G05800 unknown protein Potri.001G243108 15.58 0.8755
AT5G10310 unknown protein Potri.007G095400 18.00 0.7876
AT4G26090 RPS2 RESISTANT TO P. SYRINGAE 2, NB... Potri.001G435000 28.87 0.8583
AT2G25770 Polyketide cyclase/dehydrase a... Potri.018G046100 29.54 0.8494
AT4G27190 NB-ARC domain-containing disea... Potri.001G420000 35.51 0.8439
AT3G42170 BED zinc finger ;hAT family di... Potri.017G019466 37.13 0.8508
AT5G05830 RING/FYVE/PHD zinc finger supe... Potri.006G094000 39.16 0.8289
AT4G28220 NDB1 NAD(P)H dehydrogenase B1 (.1) Potri.013G147200 40.12 0.8425

Potri.012G140600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.