Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G48940 78 / 4e-19 Remorin family protein (.1) AT5G23750 74 / 3e-17 Remorin family protein (.1.2) AT3G61260 67 / 2e-14 Remorin family protein (.1) AT2G45820 60 / 5e-12 Remorin family protein (.1) AT4G00670 52 / 2e-09 Remorin family protein (.1) AT1G63295 42 / 1e-05 Remorin family protein (.1) AT1G30320 42 / 5e-05 Remorin family protein (.1) AT1G67590 41 / 8e-05 Remorin family protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G124400 [exp] 79 / 4e-19 AT5G23750 129 / 6e-38 Remorin family protein (.1.2) Potri.015G143600 [exp] 77 / 3e-18 AT5G23750 111 / 1e-30 Remorin family protein (.1.2) Potri.002G157700 [exp] 72 / 1e-16 AT3G61260 167 / 2e-52 Remorin family protein (.1) Potri.001G107000 [exp] 71 / 6e-16 AT5G23750 55 / 2e-09 Remorin family protein (.1.2) Potri.014G081300 [exp] 66 / 2e-14 AT3G61260 199 / 4e-65 Remorin family protein (.1) Potri.012G140800 [exp] 63 / 4e-13 AT5G23750 98 / 2e-25 Remorin family protein (.1.2) Potri.008G178300 [exp] 44 / 7e-06 AT1G67590 306 / 1e-102 Remorin family protein (.1.2) Potri.010G056800 [exp] 41 / 6e-05 AT1G67590 253 / 8e-82 Remorin family protein (.1.2) Potri.001G358600 [exp] 41 / 8e-05 AT1G30320 448 / 2e-153 Remorin family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10014785 [exp] 78 / 5e-19 AT3G61260 177 / 1e-56 Remorin family protein (.1) Lus10030379 [exp] 74 / 4e-17 AT3G61260 178 / 4e-57 Remorin family protein (.1) Lus10018840 [exp] 73 / 7e-17 AT3G61260 206 / 1e-67 Remorin family protein (.1) Lus10017811 [exp] 73 / 1e-16 AT3G61260 199 / 5e-65 Remorin family protein (.1) Lus10027460 [exp] 69 / 2e-15 AT3G61260 192 / 2e-62 Remorin family protein (.1) Lus10039215 [exp] 67 / 1e-14 AT3G61260 196 / 7e-64 Remorin family protein (.1) Lus10001477 [exp] 65 / 1e-13 AT5G23750 162 / 3e-50 Remorin family protein (.1.2) Lus10008477 [exp] 63 / 1e-12 AT5G23750 154 / 5e-47 Remorin family protein (.1.2) Lus10008014 [exp] 53 / 1e-09 AT5G23750 158 / 5e-50 Remorin family protein (.1.2) Lus10026302 [exp] 43 / 1e-05 AT3G57540 209 / 1e-67 Remorin family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF03763 [poplar] [flax] Remorin_C Remorin, C-terminal region
Representative CDS sequence Show only first row Show all	>Potri.012G140900.1 pacid=42782656 polypeptide=Potri.012G140900.1.p locus=Potri.012G140900 ID=Potri.012G140900.1.v4.1 annot-version=v4.1 ATGGGTGAAGCTCTTAAAGAAATGAACAAAGTGCTACATGAGAGAAATATCAAGGCATGGGAAGACAAAGAAAAAGCAAAATCAGCTAATAAGGCTCAGA GAATGTTATCAGACATCAAAACATGGGAGGAAAAAATGAAAATATCTCATGAGGCTAAGACCATGAAGATTGAGGCAGAATTAGAGAGCATAAGGCAACA TAAACATGAGAAAATCAAGAATGAGGAAGCTCAGATACAAAAGGCAATGGAACAAAAGAAGGCAGCCATTGATGCTCAAAACCAAAAGAAAGTTCTGGAG ATAACTGAGAAGGCTGACAAACATCGATCAAACAATACACTTCCAATGAAGTGCTTTGGTATATGTACGGACTAA
AA sequence Show only first row Show all	>Potri.012G140900.1 pacid=42782656 polypeptide=Potri.012G140900.1.p locus=Potri.012G140900 ID=Potri.012G140900.1.v4.1 annot-version=v4.1 MGEALKEMNKVLHERNIKAWEDKEKAKSANKAQRMLSDIKTWEEKMKISHEAKTMKIEAELESIRQHKHEKIKNEEAQIQKAMEQKKAAIDAQNQKKVLE ITEKADKHRSNNTLPMKCFGICTD

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G48940			Remorin family protein (.1)		Potri.012G140900 [exp]	0	1
AT3G45140		ATLOX2, LOX2	ARABIODOPSIS THALIANA LIPOXYGE...		Potri.001G015601 [exp]	1.73	0.9746
					Potri.006G164050 [exp]	1.73	0.9736
AT2G29940		ABCG31, PDR3, A...	ATP-binding cassette G31, plei...		Potri.009G045601 [exp]	2.23	0.9633
AT3G45140		ATLOX2, LOX2	ARABIODOPSIS THALIANA LIPOXYGE...		Potri.001G015500 [exp]	2.44	0.9743
					Potri.001G076600 [exp]	3.16	0.9359
					Potri.001G076700 [exp]	8.36	0.9200
					Potri.018G011950 [exp]	9.94	0.9445
AT5G21990		OEP61, TPR7	tetratricopeptide repeat 7, ou...		Potri.005G156250 [exp]	15.49	0.8711
AT1G52140			unknown protein		Potri.018G046500 [exp]	15.65	0.8902
AT4G28080			Tetratricopeptide repeat (TPR)...		Potri.018G102500 [exp]	16.61	0.9287

Compare expression of checked genes

Potri.012G140900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.