Potri.012G141000 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G25570 254 / 5e-86 ACYB-2 Cytochrome b561/ferric reductase transmembrane protein family (.1)
AT5G38630 157 / 1e-47 ACYB-1 cytochrome B561-1 (.1)
AT1G14730 108 / 5e-29 Cytochrome b561/ferric reductase transmembrane protein family (.1)
AT1G26100 100 / 1e-25 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.015G143700 317 / 1e-110 AT4G25570 297 / 8e-103 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Potri.004G103800 165 / 5e-51 AT5G38630 301 / 2e-104 cytochrome B561-1 (.1)
Potri.017G111700 164 / 1e-50 AT5G38630 321 / 2e-112 cytochrome B561-1 (.1)
Potri.008G115300 156 / 2e-47 AT5G38630 272 / 7e-93 cytochrome B561-1 (.1)
Potri.008G138300 132 / 2e-38 AT1G14730 252 / 2e-85 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Potri.010G102400 127 / 2e-36 AT1G14730 271 / 7e-93 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Potri.008G115200 109 / 4e-29 AT1G26100 270 / 6e-92 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Potri.010G131100 106 / 7e-28 AT1G26100 270 / 6e-92 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10038866 272 / 8e-93 AT4G25570 326 / 3e-114 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Lus10014986 269 / 1e-90 AT4G25570 331 / 8e-115 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Lus10039216 261 / 1e-88 AT4G25570 305 / 6e-106 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Lus10027461 241 / 3e-80 AT4G25570 287 / 3e-98 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Lus10003076 134 / 3e-39 AT5G38630 281 / 2e-97 cytochrome B561-1 (.1)
Lus10034074 129 / 4e-36 AT5G38630 287 / 7e-98 cytochrome B561-1 (.1)
Lus10034427 124 / 7e-35 AT1G14730 280 / 4e-96 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Lus10031935 114 / 3e-31 AT1G14730 284 / 8e-98 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Lus10035096 88 / 6e-20 AT2G02010 835 / 0.0 glutamate decarboxylase 4 (.1)
Lus10021715 86 / 6e-20 AT1G26100 241 / 3e-80 Cytochrome b561/ferric reductase transmembrane protein family (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0328 2heme_cytochrom PF03188 Cytochrom_B561 Eukaryotic cytochrome b561
Representative CDS sequence
>Potri.012G141000.1 pacid=42782493 polypeptide=Potri.012G141000.1.p locus=Potri.012G141000 ID=Potri.012G141000.1.v4.1 annot-version=v4.1
ATGACTATAGGGGTGGAAGCACTGCCATTAACGTTTGTTGCGCATGCGCTTGCTGTTGCTGGTGCTGTTACGGTCTTGGTTTGGAATCTATATTATAGAG
GTGGCTTAGCATGGGAAGCCACTAACAAGAGTCTCATCTTCAATCTTCATCCTGTTCTAATGCTAATTGGCTTGATTATCATTGGAGGTGAAGCCATTAT
GAGCTACAAATCTCTTCCTTTGAAGAAAGAGGTGAAGAAAGGAATACATCTTGTACTCCATGCCATTGCTATAATACTTGGTAGCGTTGGCATTGCTGCC
GCATTCAAGAATCATAATGAGAGTAACATTGCCAACCTATACAGCTTGCATTCATGGCTTGGCATATCCATCATTTCCCTTTATGGTATTCAGTGGATAT
ATGGGTTTATTGTGTTCTTCTACCCTGGAGGGTCTGCAATAATAAGGAGTGAGTCTCTCCCTTGGCATGTGCTATTTGGGATTTTTGTATATATTTTGGC
TGTTGGAAATGCTGCCTTAGGGTGTTTGGAGAAGCTTACTTTCCTTGAGAGCTCTGGAATTGACAAGTATGGTCCTGAGGCTTTGCTTGTCAACTTCACT
GCTGTGATTACAATATTATATGGCGCCTTTGTTATATTATCAGTTCTTGGCCAGGCTCCCGTAGAAGACGACGATAAATAA
AA sequence
>Potri.012G141000.1 pacid=42782493 polypeptide=Potri.012G141000.1.p locus=Potri.012G141000 ID=Potri.012G141000.1.v4.1 annot-version=v4.1
MTIGVEALPLTFVAHALAVAGAVTVLVWNLYYRGGLAWEATNKSLIFNLHPVLMLIGLIIIGGEAIMSYKSLPLKKEVKKGIHLVLHAIAIILGSVGIAA
AFKNHNESNIANLYSLHSWLGISIISLYGIQWIYGFIVFFYPGGSAIIRSESLPWHVLFGIFVYILAVGNAALGCLEKLTFLESSGIDKYGPEALLVNFT
AVITILYGAFVILSVLGQAPVEDDDK

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT4G25570 ACYB-2 Cytochrome b561/ferric reducta... Potri.012G141000 0 1
AT5G52140 RING/U-box superfamily protein... Potri.012G136400 2.00 0.8833
AT5G54850 unknown protein Potri.011G136600 4.00 0.8899
AT3G52170 DNA binding (.1.2) Potri.008G029500 10.53 0.8252
AT3G16190 Isochorismatase family protein... Potri.003G051700 13.41 0.8734
Potri.005G026425 14.66 0.8753
AT5G41761 unknown protein Potri.001G364550 14.96 0.8712
AT5G10760 Eukaryotic aspartyl protease f... Potri.018G014500 15.49 0.8575
AT4G24700 unknown protein Potri.012G086000 16.15 0.8797
AT3G04890 Uncharacterized conserved prot... Potri.013G037050 23.23 0.8178
AT2G39830 LRD3, DAR2 LATERAL ROOT DEVELOPMENT 3, DA... Potri.009G111446 27.94 0.8596

Potri.012G141000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.