Potri.012G141500 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G23760 92 / 1e-25 Copper transport protein family (.1)
AT1G01490 49 / 4e-08 Heavy metal transport/detoxification superfamily protein (.1.2)
AT5G52740 41 / 2e-05 Copper transport protein family (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.015G144200 100 / 3e-28 AT5G23760 96 / 2e-26 Copper transport protein family (.1)
Potri.001G099500 56 / 5e-11 AT1G01490 105 / 2e-29 Heavy metal transport/detoxification superfamily protein (.1.2)
Potri.003G132200 53 / 9e-10 AT1G01490 102 / 2e-28 Heavy metal transport/detoxification superfamily protein (.1.2)
Potri.017G147500 52 / 1e-09 AT1G01490 91 / 4e-24 Heavy metal transport/detoxification superfamily protein (.1.2)
Potri.004G073000 52 / 1e-09 AT1G01490 96 / 5e-26 Heavy metal transport/detoxification superfamily protein (.1.2)
Potri.014G089700 52 / 4e-09 AT1G01490 115 / 9e-33 Heavy metal transport/detoxification superfamily protein (.1.2)
Potri.017G147400 50 / 6e-09 AT1G01490 74 / 2e-17 Heavy metal transport/detoxification superfamily protein (.1.2)
Potri.002G163400 50 / 8e-09 AT1G01490 110 / 3e-31 Heavy metal transport/detoxification superfamily protein (.1.2)
Potri.004G073100 49 / 1e-08 AT1G01490 82 / 2e-20 Heavy metal transport/detoxification superfamily protein (.1.2)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10039224 79 / 9e-21 AT5G23760 81 / 1e-21 Copper transport protein family (.1)
Lus10027468 65 / 3e-13 AT5G47900 380 / 9e-130 Protein of unknown function (DUF1624)
Lus10001485 55 / 5e-11 AT5G23760 54 / 9e-11 Copper transport protein family (.1)
Lus10028762 50 / 9e-09 AT1G01490 74 / 3e-17 Heavy metal transport/detoxification superfamily protein (.1.2)
Lus10007911 50 / 1e-08 AT1G01490 128 / 2e-37 Heavy metal transport/detoxification superfamily protein (.1.2)
Lus10027524 50 / 3e-08 AT1G01490 100 / 2e-25 Heavy metal transport/detoxification superfamily protein (.1.2)
Lus10039286 50 / 3e-08 AT1G01490 97 / 2e-24 Heavy metal transport/detoxification superfamily protein (.1.2)
Lus10036395 48 / 9e-08 AT1G01490 131 / 1e-38 Heavy metal transport/detoxification superfamily protein (.1.2)
Lus10014967 44 / 2e-06 AT1G01490 100 / 9e-27 Heavy metal transport/detoxification superfamily protein (.1.2)
Lus10027523 43 / 3e-06 AT1G01490 77 / 3e-19 Heavy metal transport/detoxification superfamily protein (.1.2)
PFAM info
Representative CDS sequence
>Potri.012G141500.1 pacid=42783359 polypeptide=Potri.012G141500.1.p locus=Potri.012G141500 ID=Potri.012G141500.1.v4.1 annot-version=v4.1
ATGGCTCAGCAGAAGGTGGTGTTGAAGGTATTGACCATGACTGATGTTAAGACAAAGCAGAAAGCTATAGAAGCTGCTGCTGATATTTATGGAGTTGATT
CCATAGCAGCAGATCTAAAAGATCAGAAGCTAACAGTGATAGGTCAGATGGATACAGTGGCAGTGGTGAAAAGGCTGAAGAAAGTAGCGAAAGTGGACAT
AATCTCAGTTGGACCTGCAAAAGAAGAGAAGAAAGAAGTGAAAAAAGAAGTGAAAAAAGAGGAGAAGAAAGAGGAGAAGAAAGAAGAGAAGAAGGGAGAA
AAGAAAGAGGAGAAGAAGTAA
AA sequence
>Potri.012G141500.1 pacid=42783359 polypeptide=Potri.012G141500.1.p locus=Potri.012G141500 ID=Potri.012G141500.1.v4.1 annot-version=v4.1
MAQQKVVLKVLTMTDVKTKQKAIEAAADIYGVDSIAADLKDQKLTVIGQMDTVAVVKRLKKVAKVDIISVGPAKEEKKEVKKEVKKEEKKEEKKEEKKGE
KKEEKK

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G23760 Copper transport protein famil... Potri.012G141500 0 1
AT5G03530 ATRABALPHA, AtR... ARABIDOPSIS THALIANA RAB GTPAS... Potri.006G121400 6.32 0.7379
AT2G24960 unknown protein Potri.017G120900 7.07 0.7214
AT5G47530 Auxin-responsive family protei... Potri.010G156200 11.83 0.6999
AT2G27600 ATSKD1, VPS4, S... VACUOLAR PROTEIN SORTING 4, SU... Potri.008G022300 25.78 0.6810
AT1G76660 unknown protein Potri.005G260000 33.09 0.6857
AT2G28580 Plant protein of unknown funct... Potri.014G054200 38.36 0.6508
AT5G19070 SNARE associated Golgi protein... Potri.008G202600 39.34 0.6657
AT3G09320 DHHC-type zinc finger family p... Potri.016G100200 40.14 0.6646
AT5G61580 PFK4 phosphofructokinase 4 (.1.2) Potri.001G079501 53.44 0.6625
AT1G66170 MMD1 MALE MEIOCYTE DEATH 1, RING/FY... Potri.017G135200 66.33 0.6477

Potri.012G141500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.