Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G53740 173 / 1e-57 Ribosomal protein L36e family protein (.1.2.3.4) AT2G37600 170 / 2e-56 Ribosomal protein L36e family protein (.1.2) AT5G02450 167 / 4e-55 Ribosomal protein L36e family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G145800 [exp] 213 / 3e-73 AT3G53740 173 / 1e-57 Ribosomal protein L36e family protein (.1.2.3.4) Potri.011G066000 [exp] 209 / 4e-72 AT3G53740 173 / 2e-57 Ribosomal protein L36e family protein (.1.2.3.4) Potri.004G057000 [exp] 209 / 7e-72 AT2G37600 172 / 2e-57 Ribosomal protein L36e family protein (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10040728 [exp] 182 / 4e-61 AT3G53740 159 / 5e-52 Ribosomal protein L36e family protein (.1.2.3.4) Lus10016466 [exp] 179 / 6e-60 AT3G53740 160 / 2e-52 Ribosomal protein L36e family protein (.1.2.3.4) Lus10016501 [exp] 179 / 2e-59 AT3G53740 160 / 9e-52 Ribosomal protein L36e family protein (.1.2.3.4) Lus10024402 [exp] 177 / 3e-59 AT3G53740 161 / 9e-53 Ribosomal protein L36e family protein (.1.2.3.4) Lus10025342 [exp] 177 / 3e-59 AT3G53740 161 / 9e-53 Ribosomal protein L36e family protein (.1.2.3.4) Lus10040766 [exp] 185 / 5e-59 AT3G53740 162 / 2e-49 Ribosomal protein L36e family protein (.1.2.3.4)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF01158 [poplar] [flax] Ribosomal_L36e Ribosomal protein L36e
Representative CDS sequence Show only first row Show all	>Potri.012G142600.1 pacid=42783162 polypeptide=Potri.012G142600.1.p locus=Potri.012G142600 ID=Potri.012G142600.1.v4.1 annot-version=v4.1 ATGGCTCCAAAACAGCCAAATACGGGTCTTTTTGTGGGTTTGAATAAGGGGCATGTAGTCACGAAGAAGGATTTAGCTCCACGTCCTTCTGATCGCAAAG GGAAATCTAGCAAAAGAGTTCTCTTCGTCAGGAGTTTGATCAGGGAAGTTGCTGGCTTTGCGCCTTATGAGAAGAGGATCACTGAGCTCCTCAAGGTTGG CAAGGACAAGCGTGCTTTGAAGGTTGCTAAGAGAAAGCTTGGGACACACAAGAGAGCTAAGAGGAAGCGTGAGGAGATGTCCAATGTTCTTCGCAAGATG AGGGCTGCTGGAGGTGGTGAGAAGAAAAAGTGA
AA sequence Show only first row Show all	>Potri.012G142600.1 pacid=42783162 polypeptide=Potri.012G142600.1.p locus=Potri.012G142600 ID=Potri.012G142600.1.v4.1 annot-version=v4.1 MAPKQPNTGLFVGLNKGHVVTKKDLAPRPSDRKGKSSKRVLFVRSLIREVAGFAPYEKRITELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSNVLRKM RAAGGGEKKK

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G53740			Ribosomal protein L36e family ...		Potri.012G142600 [exp]	0	1
AT1G26880			Ribosomal protein L34e superfa...		Potri.017G082200 [exp]	1.41	0.9600	Pt-RPL34.5
AT3G05590		RPL18	ribosomal protein L18 (.1)		Potri.005G023500 [exp]	1.73	0.9571	Pt-RPL18.12
AT2G39390			Ribosomal L29 family protein ...		Potri.010G212300 [exp]	1.73	0.9607	RPL35.2
AT3G52580			Ribosomal protein S11 family p...		Potri.001G218700 [exp]	3.00	0.9344
AT5G27700			Ribosomal protein S21e (.1)		Potri.013G017600 [exp]	3.87	0.9518
AT1G57860			Translation protein SH3-like f...		Potri.006G195400 [exp]	4.00	0.9538
AT3G49010		RSU2, ATBBC1	40S RIBOSOMAL PROTEIN, breast ...		Potri.001G131000 [exp]	4.58	0.9406	ATBBC1.2
AT1G07070			Ribosomal protein L35Ae family...		Potri.010G194200 [exp]	5.83	0.9242
AT4G36130			Ribosomal protein L2 family (....		Potri.007G013101 [exp]	8.94	0.9255
AT5G59850			Ribosomal protein S8 family pr...		Potri.008G051900 [exp]	8.94	0.9161	WRP15.3

Compare expression of checked genes

Potri.012G142600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.