Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G25600 278 / 3e-93 Oxoglutarate/iron-dependent oxygenase (.1) AT3G28480 244 / 1e-79 Oxoglutarate/iron-dependent oxygenase (.1.2) AT3G28490 238 / 2e-77 Oxoglutarate/iron-dependent oxygenase (.1) AT5G18900 233 / 2e-75 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT3G06300 222 / 4e-71 P4H2, AT-P4H-2 prolyl 4-hydroxylase 2, P4H isoform 2 (.1) AT4G35810 144 / 7e-41 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT2G17720 139 / 5e-39 P4H5 prolyl 4-hydroxylase 5, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT1G20270 135 / 2e-37 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT5G66060 129 / 2e-35 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) AT2G43080 105 / 3e-26 AT-P4H-1 P4H isoform 1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G075100 [exp] 249 / 2e-81 AT3G28480 436 / 3e-155 Oxoglutarate/iron-dependent oxygenase (.1.2) Potri.008G197700 [exp] 220 / 2e-70 AT5G18900 448 / 3e-160 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.017G075300 [exp] 197 / 8e-62 AT3G28480 345 / 5e-120 Oxoglutarate/iron-dependent oxygenase (.1.2) Potri.005G245300 [exp] 138 / 1e-38 AT1G20270 483 / 3e-174 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.005G108000 [exp] 137 / 3e-38 AT5G66060 405 / 1e-143 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Potri.007G060800 [exp] 127 / 4e-34 AT5G66060 349 / 6e-121 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Potri.002G232100 [exp] 110 / 2e-28 AT2G43080 456 / 4e-164 P4H isoform 1 (.1) Potri.007G052600 [exp] 107 / 6e-27 AT4G33910 353 / 4e-123 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.010G027201 [exp] 100 / 6e-25 AT5G18900 204 / 3e-65 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10038855 [exp] 325 / 2e-110 AT4G25600 250 / 2e-81 Oxoglutarate/iron-dependent oxygenase (.1) Lus10014973 [exp] 295 / 1e-99 AT4G25600 211 / 9e-67 Oxoglutarate/iron-dependent oxygenase (.1) Lus10032183 [exp] 241 / 4e-78 AT3G28480 434 / 3e-154 Oxoglutarate/iron-dependent oxygenase (.1.2) Lus10014502 [exp] 231 / 1e-74 AT3G28480 398 / 4e-140 Oxoglutarate/iron-dependent oxygenase (.1.2) Lus10012014 [exp] 231 / 2e-74 AT5G18900 448 / 2e-160 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10016271 [exp] 229 / 1e-73 AT5G18900 444 / 2e-158 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10032184 [exp] 129 / 7e-37 AT3G28480 206 / 2e-67 Oxoglutarate/iron-dependent oxygenase (.1.2) Lus10028404 [exp] 130 / 8e-36 AT5G66060 486 / 8e-176 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10041857 [exp] 130 / 1e-35 AT5G66060 488 / 2e-176 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10005620 [exp] 117 / 1e-30 AT1G20270 465 / 7e-167 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0213 [poplar] [flax] ShK-like PF01549 [poplar] [flax] ShK ShK domain-like
Representative CDS sequence Show only first row Show all	>Potri.012G142800.1 pacid=42783969 polypeptide=Potri.012G142800.1.p locus=Potri.012G142800 ID=Potri.012G142800.1.v4.1 annot-version=v4.1 ATGGCTTCCTTTGTCTACCTTCTTCTCTTCATGGTGCTTACACTTACAACCCAATTCTCCCTCTGTTTCGGAAAGAGTAGCCGAAAGGAATTAAGGAACA AGGAGGCCCACCTTGAAACAATGATACAATTTGGAAGCTCAATTCAGACCAACTGGGTAGACCCATCAAGAGTTGTCACGGTCTCTTGGCAACCAAGGGT GTTCGTGTACAAAGGCTTTTTGACAGACGAGGAATGTGATCATCTTATTTCTTTGGCACAGGGTACAAAAGAAACTTCTGAGGGAAAGGATGATGATTCA GGGAGAATTGAGAGAAACAGGCTGTTTGCAAGCTCGACTTCTCTTCTAAACATGGATGATAACATACTTTCAAGGATTGAAGAAAGAGTTTCAGCTTGGA CTCTCCTTCCAAAAGAGAACAGCAAACCCCTGCAGGTCATGCATTATGGAATTGAAGATGCCAAAAACTACTTTGATTATTTTGGTAACAAATCTGCAAT CATTTCAAGCGAGCCTTTGATGGCAACTCTGGTTTTTTATCTCTCTAATGTCACCCAGGGTGGTGAGATATTCTTCCCTAAGTCAGAGGTTAAAAACAAG ATTTGGTCTGATTGTACAAAGATTAGTGATTCCCTTCGACCGATTAAAGGGAATGCAATTCTGTTTTTCACAGTGCATCCTAATACATCTCCGGACATGG GTAGCTCCCATTCCAGATGCCCTGTCCTTGAGGGCGAAATGTGGTACGCCACCAAAAAGTTTTATTTAAGAGCCATTAAGGTCTTTTCTGACTCCGAAGG AAGTGAATGCACCGATGAAGATGAAAATTGTCCAAGCTGGGCTGCTCTCGGAGAATGCGAAAAGAACCCTGTGTATATGATTGGTTCCCCCGATTACTTT GGGACATGTAGGAAGAGTTGTAATGCTTGTTGA
AA sequence Show only first row Show all	>Potri.012G142800.1 pacid=42783969 polypeptide=Potri.012G142800.1.p locus=Potri.012G142800 ID=Potri.012G142800.1.v4.1 annot-version=v4.1 MASFVYLLLFMVLTLTTQFSLCFGKSSRKELRNKEAHLETMIQFGSSIQTNWVDPSRVVTVSWQPRVFVYKGFLTDEECDHLISLAQGTKETSEGKDDDS GRIERNRLFASSTSLLNMDDNILSRIEERVSAWTLLPKENSKPLQVMHYGIEDAKNYFDYFGNKSAIISSEPLMATLVFYLSNVTQGGEIFFPKSEVKNK IWSDCTKISDSLRPIKGNAILFFTVHPNTSPDMGSSHSRCPVLEGEMWYATKKFYLRAIKVFSDSEGSECTDEDENCPSWAALGECEKNPVYMIGSPDYF GTCRKSCNAC

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G25600			Oxoglutarate/iron-dependent ox...		Potri.012G142800 [exp]	0	1
AT2G30910		ARPC1B, ARPC1, ...	actin-related protein C1A (.1....		Potri.014G141700 [exp]	1.00	0.9434	Pt-ARPC1.1
AT5G08160		ATPK3	serine/threonine protein kinas...		Potri.015G055200 [exp]	2.00	0.9197
AT2G24765		ARF3, ARL1, ATA...	ARF-LIKE 1, ADP-ribosylation f...		Potri.018G096077 [exp]	3.16	0.9146
AT5G21070			unknown protein		Potri.009G158800 [exp]	4.89	0.9191
AT5G55630		ATTPK1, ATKCO1	TWO PORE K CHANNEL 1, TWO PORE...		Potri.001G366800 [exp]	5.09	0.8753
AT1G11890		ATSEC22, SEC22	SECRETION 22, Synaptobrevin fa...		Potri.001G165600 [exp]	5.29	0.9152	Pt-SEC22.1
AT1G79820		SGB1	SUPPRESSOR OF G PROTEIN BETA1,...		Potri.001G185300 [exp]	6.00	0.9017
AT3G58130			N-acetylglucosaminylphosphatid...		Potri.012G041700 [exp]	6.92	0.9025
AT1G09330		ECHIDNA, ECH	unknown protein		Potri.013G006250 [exp]	7.74	0.9143
AT5G25760		PEX4, UBC21	ubiquitin-conjugating enzyme 2...		Potri.018G039200 [exp]	8.12	0.8968

Compare expression of checked genes

Potri.012G142800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.