Potri.013G000100 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G05936 59 / 3e-12 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G000800 186 / 6e-62 AT3G05936 57 / 2e-11 unknown protein
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.013G000100.1 pacid=42812642 polypeptide=Potri.013G000100.1.p locus=Potri.013G000100 ID=Potri.013G000100.1.v4.1 annot-version=v4.1
ATGCTGCAGGTGGGTTTCGAAGCTGTTGTTGGAATGCACTCGAGGTTCCGCTACGAGAAGCTCAGCAATGGCGAGGATCAAAATCATGAAAAGTTAATGG
CAAGGCCAAGGAGAAGGCATTGTTGGGTGAAGAAAATGAATGGAAGAGTAAAGGGTCTACGCTTATCCCGCTCCAGGAAACTTACTTTCAAGGCATTGTC
TGTGATCCTAATGCCAAGCCCAAGCAGCAGGATTGCCAAAGTGTATGCTCATATTATTGATAGAATCAAGATTATGGATGATCTGAATCTGTATCCGAAT
ATTATCCTTTCCACTCGTTGGGGTCTTCCAGGTTTATCTCATCCCCATCCCTCTGTTAAAACCGCTGGAAGGCCGACTCATACCACTGCGCCTCCCATGC
CTCTTCATAAAATTTAA
AA sequence
>Potri.013G000100.1 pacid=42812642 polypeptide=Potri.013G000100.1.p locus=Potri.013G000100 ID=Potri.013G000100.1.v4.1 annot-version=v4.1
MLQVGFEAVVGMHSRFRYEKLSNGEDQNHEKLMARPRRRHCWVKKMNGRVKGLRLSRSRKLTFKALSVILMPSPSSRIAKVYAHIIDRIKIMDDLNLYPN
IILSTRWGLPGLSHPHPSVKTAGRPTHTTAPPMPLHKI

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G05936 unknown protein Potri.013G000100 0 1
AT1G79670 WAKL22, RFO1 RESISTANCE TO FUSARIUM OXYSPOR... Potri.001G040884 46.79 0.7959
AT5G59305 unknown protein Potri.001G237700 74.09 0.7857
AT5G09950 Tetratricopeptide repeat (TPR)... Potri.016G001950 89.44 0.7712
AT5G11160 APT5 adenine phosphoribosyltransfer... Potri.006G255900 105.59 0.7712 Pt-APT2.2
AT4G14700 ORC1, ATORC1A, ... origin recognition complex 1 (... Potri.009G054300 120.91 0.7702 Pt-ORC1.1
AT3G58850 HLH2, PAR2 phy rapidly regulated 2 (.1) Potri.005G201500 197.27 0.7519
Potri.010G206700 205.70 0.7518
AT1G15670 Galactose oxidase/kelch repeat... Potri.001G178500 245.83 0.7363

Potri.013G000100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.